KEGG   Empidonax traillii (willow flycatcher): 114068767Help
Entry
114068767         CDS       T05887                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114068767 (NKX3-1)
Transcription factors [BR:etl03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    114068767 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 114068767
NCBI-ProteinID: XP_027760934
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSAGALQGRRQSSPSSAPVEMNRTPPAPQQPIPVSSRPRTSFLIQDILRDGAERGARLDR
GRSRGFGSPGNGEMGAAPAEGREGNSAPGNKPRSPHPTGASHGTGTPREVDTDSTVESYL
AGCDPPLPASPRPPKPPKRSRAAFSHSQVIELERKFSHQKYLSAPERAHLAKNLQLTETQ
VKIWFQNRRYKTKRKQGMARPDSSLGGHKGAELPGASLLALRAAWPYLPCLYYLHGWSPS
W
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggggcgctccagggaaggaggcagagctcacccagcagcgccccggtagag
atgaaccggacccccccggccccccagcagcccatcccggtctcctccaggcccaggaca
tccttcctcatccaagacatcctccgggatggggcagagcgaggagcacggctggacagg
ggcaggagcagagggtttggcagccccgggaatggggagatgggagcggccccggccgag
ggcagggaggggaactcggcccccggcaacaaacccaggagcccccaccccacgggagca
tcccacggcacggggacaccccgggaagtggacacagattccacggtggagagttacctg
gcggggtgtgatccccccctgcccgcatcccctcgcccccccaagccccccaagcgctcc
cgggccgccttctcccacagccaggtgatcgagctggagaggaaattcagccaccagaag
tacctgtcagccccggagagagcccacctggccaagaacctgcagctcaccgagacccag
gtgaagatctggttccagaaccgcaggtacaagaccaagaggaaacaggggatggcccgg
ccggactcttccctgggggggcacaaaggggcagagctgccgggggcatcgctgctggcc
ctcagggcagcctggccctacctgccctgcctctactacctgcacggctggagcccctcc
tggtag

DBGET integrated database retrieval system