KEGG   Empidonax traillii (willow flycatcher): 114068803
Entry
114068803         CDS       T05887                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114068803 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:etl04030]
    114068803 (PTGDR)
G protein-coupled receptors [BR:etl04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    114068803 (PTGDR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 114068803
NCBI-ProteinID: XP_027760983
LinkDB
Position
Unknown
AA seq 360 aa
METKGYQCRSSRYIESGQSAVPSSVLFAAGLLGNVLALLLLGQHRRRSRSPGGRPPRVSA
FYVLVTVLAVTDLLGKCLLSPIVLAAYAYNRSLSELGPGGRGEDEPGVLCQLFAFLMAFF
GLAPTLLLLAMALECWLSLGHPYFYRRHLTRRLGVALGPAAGGLCALFCALPLLGFGVPM
QYCPGTWCFIRMAGGGPRELGFPVLYAGLMGLLVVAIGACNVSSMRHLYGMARRQPRRGT
PTAAAPRMEELDHLVLLGLMTVLFTVCSLPLIIRAYMGAFAADINENADLSALRFLSVNS
IVDPWVFIIFRTSVFRSFVRRVCRRLHSRKSSLKGSDPGGDGQFCPPGWRRTDPPRLGIP
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggagacgaagggctaccagtgccgcagcagccgctacatcgagagcgggcagtcggcc
gtgcccagctcggtgctcttcgccgccgggcttttggggaacgtcctggccttgctgctg
ctgggccagcaccggcggcgttcccggtcgcccgggggccgcccgccgcgggtctcggcg
ttctacgtgctggtgaccgtgctggccgtcaccgacctgctgggcaagtgcctgctgagc
cccatcgtgctggccgcctacgcctacaaccgcagcctcagcgagctggggccgggcggg
cgcggcgaggacgagccgggcgtcctgtgccagctcttcgccttcctcatggccttcttc
gggctggcccccaccctgctgctgctggccatggcgctggagtgctggctgtccctggga
cacccctacttctaccggcggcacctcacccgccggctgggggtcgcgctggggccggcg
gcgggcgggctgtgcgcgctgttctgcgccctgcccttgctgggcttcggggtgcccatg
cagtactgcccgggcacctggtgcttcatccgcatggccggcgggggcccgcgggagctg
ggcttccccgtgctctacgccggcctcatggggctgctggtggtggccatcggcgcctgc
aacgtgagcagcatgaggcacctgtacggcatggcccgccggcagccccgcagagggacc
cccaccgccgccgccccccgcatggaggagctcgaccacctcgtcctgctcggcctcatg
accgtcctcttcaccgtctgctccctgccgctcatcatccgggcgtacatgggggccttc
gccgccgacatcaacgagaacgccgatctcagcgccctgcggttcctctccgtgaactcc
atcgtggatccctgggtcttcatcatcttccgcacctccgtgttccgctcgttcgtccgc
agggtttgccggaggctccactcccgcaaatccagcctgaaagggtccgacccgggcggt
gacggccagttctgtcccccgggctggcgcaggacagacccgccgcggctcggcatcccc
tga

DBGET integrated database retrieval system