KEGG   Empidonax traillii (willow flycatcher): 114069005
Entry
114069005         CDS       T05887                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
etl04217  Necroptosis
etl05164  Influenza A
etl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114069005 (BID)
   04217 Necroptosis
    114069005 (BID)
   04115 p53 signaling pathway
    114069005 (BID)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114069005 (BID)
   05168 Herpes simplex virus 1 infection
    114069005 (BID)
SSDB
Motif
Pfam: BID CRM1_C HBD
Other DBs
NCBI-GeneID: 114069005
NCBI-ProteinID: XP_027761331
LinkDB
Position
Unknown
AA seq 218 aa
MEQPVVCKLLPCYLSVTLPLEIAGWRCSYMEHALLYTFLEASSDCKFKDQLWSLKSPGPA
VFQGLSDRRISQPVSAFDDEFELQCDGNRSGHFQNGELESDATVDEDVIRIIAAQLAKIG
DKLDKDVQARAVDDLVQYFLNESLSRQEIMRHMSRVVTELAQAIPSDMEQEKFMLVLTMV
LTKKIVNTVPSLLHRVFSTSVNFISEQFHNYVVEMLGE
NT seq 657 nt   +upstreamnt  +downstreamnt
atggaacaacctgtagtttgcaagctgcttccttgttatctctctgtgacactccctctt
gaaattgcaggctggagatgtagctatatggagcacgcactgctgtacaccttcctggag
gcatcctctgactgcaagttcaaagaccagctgtggtccctgaaaagcccagggcctgct
gttttccaagggctctctgaccggaggatctctcagccggtttcagcctttgatgatgag
tttgagctccagtgtgacggcaatcggagcggccacttccagaacggtgagctagagtct
gatgctacggtagatgaagatgttatccggatcattgctgctcagctcgctaagattgga
gacaagcttgacaaagatgtccaagcaagagcagtagatgatctagtgcagtactttctg
aatgagagtctctctagacaggagataatgcggcacatgtctcgggtagtgacagagctt
gcacaagccatcccctcagacatggaacaggagaagttcatgttggtgctaacaatggtc
ttgactaagaaaattgtgaatacggtgccctcccttctacaccgtgtcttcagcacctct
gtgaacttcatcagtgagcagttccacaactacgttgtcgaaatgctgggtgagtga

DBGET integrated database retrieval system