KEGG   Empidonax traillii (willow flycatcher): 114069335
Entry
114069335         CDS       T05887                                 

Gene name
CUL3
Definition
(RefSeq) cullin-3
  KO
K03869  cullin 3
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04120  Ubiquitin mediated proteolysis
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114069335 (CUL3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114069335 (CUL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114069335 (CUL3)
   03400 DNA repair and recombination proteins [BR:etl03400]
    114069335 (CUL3)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     114069335 (CUL3)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     114069335 (CUL3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 114069335
NCBI-ProteinID: XP_027761853
LinkDB
Position
Unknown
AA seq 746 aa
MTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVT
EHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNL
GLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYE
EDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVK
VVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKTMCECMSSYLR
EQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFNNDRLFKQTIAGDFEYFLNLNS
RSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLT
NKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVD
LTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNAT
FYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDI
PERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQG
ESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIK
KRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgactatggatgagaaatatgtgaacagcatttgggatcttctgaaaaatgcaatccaa
gagatccagcgtaagaacaatagcggtctcagttttgaggagctgtataggaatgcatat
acaatggtgttgcacaaacacggtgaaaaactctacactggactaagagaagtggtcact
gagcatctaataaacaaggtgcgagaagatgtgttaaactccttgaataacaactttcta
caaacactaaaccaagcgtggaatgatcatcaaacagcaatggtgatgattagagacatt
ctgatgtatatggaccgtgtgtatgtgcaacaaaacaatgtggagaatgtctacaatttg
ggcttgattatttttcgagatcaagtagttcgctatggctgcattagggatcacctgcga
caaactctgctggatatgattgcgagagaaaggaaaggagaagttgtagacagaggcgca
ataagaaatgcttgccagatgttaatgattctaggtcttgaaggaaggtcagtctatgaa
gaagacttcgaggctccatttttggagatgtctgcagaattttttcagatggaaagtcaa
aaatttttagctgaaaacagtgcttctgtatatataaagaaagtagaagctagaattaat
gaagaaatagaacgggtgatgcattgtctggataaatcaacagaagaacctattgtgaaa
gttgttgagagggagcttatttccaagcacatgaaaactatagtggaaatggagaactct
gggctagttcatatgctgaaaaatgggaagacagaagaccttgcttgcatgtacaagttg
ttcagccgtgtgccaaatggtctgaagacgatgtgcgagtgcatgagctcatacctgaga
gagcaaggcaaagcactagtttctgaagaaggagaaggaaagaatccagttgactatatt
cagggtttgctggacttgaagagtaggtttgatcgctttcttcaagaatctttcaataac
gatcgactcttcaaacagactattgcgggtgactttgagtacttcctcaacctcaactcc
aggtctccagagtacctctcattatttattgacgataagctgaaaaagggagtcaaggga
ctaacagagcaagaagtagaaactatattggataaggcaatggttttattcaggtttatg
caagagaaagatgtttttgaacgctactacaagcagcacttggcaagaaggcttctcaca
aacaagagtgtttcagatgactctgagaaaaatatgatatccaaattaaagactgaatgt
ggatgtcagttcacatctaaactggaaggaatgttcagggacatgagcatctcaaatacg
acgatggatgagttcaggcaacatcttcaggcgacaggggtctcattgggtggtgttgat
cttacagtgcgtgtcctcacaacaggttactggcctacccagtcagccacaccaaagtgt
aacatccctccagctcccagacatgcttttgaaatatttagaagattttatttagccaaa
catagtgggcgacagctgacactccagcatcatatgggttctgcagatctcaatgccact
ttctatgggcctgtcaaaaaggaagatggctcagaagtcggcgtgggaggtgcccaagta
actggctcaaatacacggaagcacatattgcaagtctccactttccagatgacgatatta
atgctctttaacaacagagaaaaatacacatttgaggaaattcaacaagaaactgatatc
cctgaaagagaactggttagagccctacagtcccttgcatgtggaaaaccaacacaacgt
gttctcacaaaagagcctaaatcaaaagaaatagaaaatggtcatatatttacagtgaat
gatcagttcacatctaagctacacagggtcaagattcagacggttgctgccaaacaagga
gaatctgatccagaaaggaaagaaacgaggcagaaagtagatgatgacagaaaacatgag
atagaagctgctatagttcggataatgaaatctagaaagaagatgcaacacaatgtgcta
gtagcagaggtaactcagcagctgaaggcccgattcttaccaagtccagttgttattaaa
aaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggatcgcaaa
gtgtacacttacgtagcataa

DBGET integrated database retrieval system