KEGG   Empidonax traillii (willow flycatcher): 114069637
Entry
114069637         CDS       T05887                                 

Gene name
ATR
Definition
(RefSeq) serine/threonine-protein kinase ATR
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl03460  Fanconi anemia pathway
etl04110  Cell cycle
etl04115  p53 signaling pathway
etl04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    114069637 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114069637 (ATR)
   04115 p53 signaling pathway
    114069637 (ATR)
   04218 Cellular senescence
    114069637 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114069637 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:etl03400]
    114069637 (ATR)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114069637 (ATR)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   114069637 (ATR)
DNA repair and recombination proteins [BR:etl03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    114069637 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I Dopey_N TRIF-NTD
Other DBs
NCBI-GeneID: 114069637
NCBI-ProteinID: XP_027762376
LinkDB
Position
Unknown
AA seq 2660 aa
MAEQGLGMASMIPALRELAGASPEEYNTVVQKPRQILCQFIDRILTDVDVVALELIKKSD
SQPSSVMLLDFIQHIMKSSPLMFVNVDGNQEETECSCIEFSNWIITRLLRIAAAPNCSTL
HRNIAEVICSLLFLFKVKSCSVFEVLTKDLLQLFQDLIILHERDAQKDLRGNGLTWPVTV
KRFSSNISDTVGYLRLAPLQLMGMPNVECLEVILMSVLTDIVADVFFARQDIVLWGIGCS
LLDYGCPKVKTLAMKFLVKLIHLGGPPEQLASVFFTVFLEVLQSTLGMDTEESELLGEPL
LLLVRTLLPFEADFYKKIEPVYLNMLLEKLCALFEGDVFRCLQSEKLKTAFCHILQYFLE
FVPAGYESALQVRKAHISTICGIFVNGLGTQEEQEYLVSPLYTVLKTQAEEIFQELQENQ
QEASDTDGWSSSSDEIPEKRRRLSLPSKHPKKSPPPSTRSPVNMRQKSSLWNAVTRKAAS
LLSSLEEEAVAGDVVQPVEGIAVVVRLAALAMVHCSPPATSASIDHKVFHPCDSGTCKSS
PSSSDSVVNTQFKWLSPDFITRVVKVCRNLLEAATQLVNLEQVIDRIVKIFDALLYAQGK
TPLSDQTLDHLCALLSLPWICSHLDDSCFKPSLLGFDPLVLSQKTAQSFSPRTQSHCVLL
LSLFPRNIHLDWRKSIYHWALQSPHEVIRATCVKGFSLLLHPPTVQSCSTIPKALLNQIQ
DESELVKEACAAIVGNLSCCLSGTLCVQPSLADSAIKHLTDDILCSSLTGTAAHGRTCSV
QACVFKPFLVLLEREAASSVKLAFIENIPHLCKHLDFNTDESSVKILVGSLLNLMEDPDK
DVRVAFSGCIKNILESLDSEEGFIKELFVSRMKEAYTNAKLSRNNELKDTLILTTGDIGR
ASKGDLVPFALLHLLHCLLSKSAAVAGAAFAEIRALAAARAVRLQAFFSQYKKPICQFLV
ESLHSSQMVVLSSPGQGNELQKQTADHQREMALDVLTEIASVFDFPDLNRFLSRTLQVLL
PDLAAKASPAASTLIRTIAKQLNVNRREILINNFKYIFSHLVCSCTKDELERALHYLKNE
TEIELGSLLRQDYQGLHNELLLRIGEHYQQVFNGLAILASFASHDDPYRGPREITSPEQM
ADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALNSLRSLMKLMGPKHVSSVRVKMMTTLR
TALRYKDDFPELCCRAWDCFVRSLDHSYLGSLLSHVIVVLLPLIHIQPKETTAIFHFLIV
ENRDAVRDFLHEIYFLPDLPELKEIQVVLQEYRKESSKSTDLQRALQLSMRAIQHENVDV
RIHALTSLRETLYRNQDKLIKCVTDSETVEPFISQLVTVLLIGCQDANPQARLLCGECLG
ELGAVDPGRLDFSTGETQGKHFTFVAGVEDPNFAYGLLMELTRAFLAYADNVRAQDSAAY
AIQELLSIYECRETNTDCPGSRLWRSFPEHVQEILEPHLNTRYKSYQKAVNWSKVKKPIY
LSKLGYNFAEWSATWAGYLITKVRHDLARKVFDCCSIMMKNDYKVTIYLLPHILVYVLLG
CSQEDQQEVYMEIMAVLKHDDQPSRRLEDSASDLSQLSTQTVFSMLDHLTQWARHKFQIL
IAEKNTAKSSKDRSDLKTCSEDYGEYQNVTRFLDLIPQDTLAVASFRSKAYTRAVMHFES
FITEKKQNIQEHLGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATA
CYDRAIQLEPDEIIHYHGVVKSMLGLGQLSTVITQVNGVLANRPEWISELNTYRVEAAWK
LSRWDLLENYLASDVKSTTWSVRLGNLLLSAKKKNEAAFYETLKVVRAEQIVPLSAASFE
RGSYQRGYEHIIRLHMLCELEHSIGPTFQHPDGDLSRDTLNWCARIEMTQNSYRAKEPIL
ALRRALLSLSKSQDYSELVGQCWLQSARVARKAGHHQTAYNALLNAGESSLSELYIERAK
WLWSKGEVHEALIVLQKGVDLCFPENKAPCDSKNQLIHGRAMLLVGRFMEETANFESNAV
MKKYKDVTNFLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVHHFGRSLQYGNQ
FIYQSMPRMLSLWLDFGAKAYECDKASRSERVQMKHDLAKINKVITEHTNHLAPYQFLTA
FSQLISRICHSHDEVFAVLMVIVAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNRA
THMKESLGKFIGDATRLTDKLLELCNKPVDGNSSTLSMNIHFKALKRLVEEPTFSEILIP
LQSVMIPTLPSTPGTHSNHDPFPGCWAYIAGFDDTVEILASLQKPKKITLKGSDGKSYIM
MCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTA
GLRNILIKLYKEKGIYMTGKELRQHMLPKSAPLPEKLKMFKEVLLPRHPPLFHEWFLRTF
PDPTSWYNSRSAYCRSVAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGET
FEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVE
WSKPVKGNTRAQVNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRIKGLPLSIEGHVHYLI
QEASDDNLLCQMYMGWAPYM
NT seq 7983 nt   +upstreamnt  +downstreamnt
atggcggagcagggcctgggcatggcctccatgatccccgcgctgcgggagctcgccggt
gctagcccagaagaatacaacaccgttgtgcagaaaccaagacaaatcctctgccagttt
attgacaggattcttacagatgtggatgttgttgctttggaactaattaagaaatccgat
tcacagccaagttctgtgatgttacttgattttattcaacatatcatgaaatcttccccc
cttatgtttgtaaatgtggatgggaatcaggaggaaactgaatgcagctgcattgagttc
agtaactggatcatcacgaggctcctccgaatcgctgcagctccaaactgcagcaccctg
cacaggaacattgctgaggtcatctgctctttgctctttctgttcaaagtgaagagctgc
tccgtttttgaggtactgactaaagacttgctgcagcttttccaagacttaatcatcttg
cacgaaagagatgcacagaaagatctcaggggaaatggactgacctggccagtgactgtg
aagagattctcaagcaatataagtgacacagtgggatatttaagactggcaccactgcag
ctgatgggtatgcccaatgtggagtgtttggaggttatattaatgtctgttctgacagat
attgttgcagatgtgttttttgccagacaggatattgttctctgggggataggctgctcc
ctgttggactatggctgtccaaaagttaaaactttggccatgaagtttctggtgaaatta
attcatttgggaggacctccggaacaactggccagtgttttcttcacagtctttcttgaa
gttctgcagtcaacccttggaatggatactgaggaatcagaactccttggagaaccactc
ttactgttagtgaggacgttgttgccttttgaagcagatttttacaagaagattgaacct
gtctacttgaacatgctgctggagaagctctgtgcactgtttgagggggatgtgttcagg
tgtcttcagtctgaaaagcttaaaactgctttttgccatatcctgcagtattttctggaa
tttgttccagctggctacgaatctgccttacaagtaagaaaagcccatatcagtaccata
tgtgggatttttgtgaacgggcttggaactcaggaggaacaagagtacctggtgagccca
ctttacacagtgttaaaaacacaagcagaagaaatcttccaggagcttcaggagaaccag
caggaggcttctgacaccgatggctggagcagcagcagcgatgaaattccagagaaaagg
cgacggctgagcctcccctcaaagcatccgaagaaatcacctcccccttcaacccgtagc
cctgtgaacatgagacagaagagctctctctggaacgctgtcactaggaaagctgcatcc
ttactatccagccttgaggaggaagctgtggcaggggatgttgtgcagcccgtggaaggc
attgccgtggttgtacgactggctgctctggccatggtccactgttctcccccagcaact
tctgccagtatagatcataaagtatttcatccatgtgactctggcacgtgtaagagttct
ccaagctcctcagattctgtggtgaatacacagttcaagtggctttcccctgattttatc
acaagagtggtgaaagtctgcagaaacctgttagaggctgctacacagcttgttaatctg
gaacaagtgattgacagaatagtgaaaatctttgatgccctgctgtatgcacaagggaaa
actccactgagtgatcagactctcgatcacttatgtgcattgctgtctctgccctggatt
tgcagccatcttgatgattcttgttttaagccatctcttttggggtttgatcctctagtt
ttgagtcaaaaaactgcccagagtttctcaccccgaactcagtcacactgcgtgctcctt
ctgtctctcttcccaagaaacatccatctggactggagaaaatccatttaccattgggca
ctgcaaagtccccatgaagtaattcgggctacttgtgttaaaggattctcccttctgctc
catccccccactgtgcagtcctgcagcaccattcccaaagcactcctaaatcaaatccaa
gatgagtctgagctggtgaaggaggcttgtgctgccatagttgggaacttatcttgctgc
ctctctgggacactgtgtgtgcagccctccctggcagactctgccatcaaacatcttact
gatgatattctgtgcagcagcctcactgggactgctgctcatggcagaacttgttctgtg
caggcctgtgttttcaagccatttctcgttctcctggagagggaagcagccagttcagtc
aagctggcatttatagaaaatatacctcatctttgcaaacatctggatttcaacactgat
gagtccagtgtgaagattcttgttgggtctttattaaatctgatggaagatccagacaaa
gatgtaagagtggctttcagtggctgcataaagaacatactggaatccttagactctgag
gaaggattcataaaagagctgtttgtttcaagaatgaaagaagcctatacaaatgccaaa
ctatcaagaaacaatgagcttaaagataccttgatcctcacgacaggagatattggaagg
gcatccaagggggatttggtcccgtttgccctcctgcatttgctgcactgtttgctgtcc
aagtcggcggccgtggcgggggcggcgttcgccgagatccgcgcactggcagcggccagg
gctgtcaggctgcaggccttcttcagccagtacaagaaacccatctgccagtttctcgtg
gagtccctgcactccagccagatggtggtgctgagttctccaggccagggcaatgagctg
cagaaacaaacagctgatcaccagagagaaatggctctggatgtgttaactgagattgcc
agtgtgtttgatttcccagacctcaatcgctttctgtcgcggaccctgcaggttctgctt
cccgaccttgcagccaaggccagtcctgcagcctccacactcatcagaaccatcgccaag
cagctgaacgtcaaccggagagagatcctgatcaacaacttcaaatacatcttctctcac
ttggtctgctcctgcaccaaggacgagctggagcgggcactgcattacctcaagaatgag
actgagatagagctgggcagcttgctgaggcaggactaccaggggctgcacaacgagctg
ctgctgcgcataggggagcactatcagcaggtcttcaacggcctggccatactggcctcg
ttcgcctctcacgacgatccctaccggggacccagggaaatcacatcccccgagcagatg
gctgattatctccaacctaaattgcttggtatcttggctttttttaacatgcagttactg
agttccagcgttggcattgaagataaaaaaatggctttaaacagtcttaggtctctgatg
aagctcatggggcccaagcacgtgagctcggtcagagtgaagatgatgaccaccctgagg
acagctctgagatacaaggatgacttcccagaactgtgctgcagagcttgggattgtttc
gttcgaagcctggaccattcctacctgggctccttgctcagccatgtgatagtggtgtta
ttgcccctaattcacatccagcccaaggaaaccacagcaatattccacttcctcatagtt
gagaacagggatgcagtacgagacttcctccatgaaatatattttctgcctgaccttcct
gaactaaaagaaattcaggttgtccttcaggagtacagaaaggaatcctccaagagcacg
gacttgcagagggcgctgcagctgtcgatgagagccatccagcacgagaacgtggatgtt
cggatccacgccctcaccagcctgagggagacgctctacaggaatcaggacaaactgatc
aagtgtgtgacagacagtgagactgtggagccgttcatctcccagctggtcactgtgctg
ctcatcggctgccaggatgccaatcctcaggctcggctgctctgtggggaatgtttgggt
gagctgggggccgtagatcctggcaggctcgacttttcaaccggcgaaactcagggaaaa
catttcacatttgtggctggtgtggaagatccaaattttgcctatggattattaatggaa
ctgaccagagcattccttgcctatgctgataatgttcgtgctcaggattctgcagcatat
gcaattcaggagctgctgtcaatctatgagtgcagggagaccaacactgactgccctggc
tccaggctctggaggagctttcctgagcacgtgcaggagatcctggaacctcacctcaac
acacggtacaagagttaccaaaaggctgtaaattggtctaaggtgaagaagccaatctac
ttaagcaaattgggttataattttgcagaatggtcagcaacgtgggcaggttatcttata
acaaaggtgcgccatgatctcgccaggaaggttttcgattgctgcagtataatgatgaaa
aatgactataaggtgacaatttatctgcttccacacatcctggtctatgttttgttggga
tgcagtcaagaggatcagcaagaggtttacatggagatcatggcagtgctgaagcacgat
gaccagcccagcaggaggctggaggacagtgcctctgacctcagccagctgagcactcag
acagtgttctccatgctcgatcatctcacccagtgggcgaggcacaagtttcagatactc
attgctgagaaaaacactgccaagtctagcaaagacaggagcgacctgaagacatgcagt
gaggactatggggaatatcagaacgtgacccgtttcctggacctcatccctcaggacacg
ctggccgtggcctccttccgctccaaggcttacaccagggccgtgatgcacttcgagtca
ttcatcacagagaagaaacagaacatccaggagcacctcggctttcttcagaagttgtac
gctgccatgcacgagcccgatggagtggccggggtcagcgccatccgcaaggcagagcct
tccctcaaggagcagatcctggagcatgaaagtattggcttgttgagagatgcaacagcc
tgctatgacagagccatccagctggaacctgacgagattatccactatcacggtgtggtg
aagtccatgctaggccttggtcagttatccacggtgattactcaggtgaatggagtgctg
gcaaacaggcctgaatggatttctgaattgaacacttacagggtggaagcagcctggaaa
ctgtcccgatgggatttactggaaaattatttagcttcagatgtgaagtccaccacttgg
agtgtcagactgggcaatttattgttatcagccaagaagaaaaatgaagcagctttttat
gagacgctcaaggtggttcgggcagagcagatcgtgcccctttcagcagcgagctttgaa
agaggatcctaccagcgaggatacgaacacatcatcaggttgcacatgctgtgtgagctg
gagcacagcatcgggccaacgtttcagcacccagacggtgacctcagcagggacaccctc
aactggtgtgctcggatcgagatgacccagaactcctacagagccaaggaacccatttta
gctctgaggagggctctgctcagcctcagtaaaagccaggattacagtgagctggttggc
cagtgctggctccagagtgccagagtggccaggaaagctgggcatcaccagactgcctac
aatgccctcctgaacgctggggaatcctcactctctgaactctacattgagagggcaaag
tggctctggtccaagggtgaggttcatgaagcactcatcgttctccagaagggggtggat
ttatgtttccctgaaaataaagcaccctgtgacagcaaaaaccagctgatccacgggcgg
gcgatgctgctggtgggcaggttcatggaggagactgccaactttgagagcaatgcagtc
atgaagaagtataaggatgttacaaatttcttgccagaatgggaagatggacatttttat
cttgcaaaatactatgataaattaatgcccatggtgactgacaacaagatggaaaagcaa
ggagatctgattagatacattgttcatcattttgggaggtctctgcagtatggaaaccaa
ttcatctaccagtcaatgccaaggatgttgtctttatggctggactttggggcaaaagca
tatgaatgtgataaagccagtcgatcagagcgcgtccagatgaagcacgatctggccaag
atcaacaaggtgatcacagagcacacaaaccacctggcaccttaccagttcctgacagcc
ttctctcagctcatctcccgcatctgccactcccacgacgaggtgtttgcagtgctgatg
gtgattgttgccaaagtgttcttagcctacccccagcaggccatgtggatgatgactgct
gtgtccaagtcctcttatccaatgcgtgtcaataggtgcaaggagattctaaacagagct
actcacatgaaggaatctctagggaaattcattggagatgccacccgcctgacagacaag
ctgttagaactgtgcaacaaaccggttgatgggaacagctcaacgttaagcatgaatatc
catttcaaagcactgaaaagattagtagaagagcccacattcagtgaaattctcattccc
ttgcaatctgtcatgataccaactctgccttccactcctggcacgcactccaaccacgac
cctttccctgggtgctgggcctacattgcaggctttgatgacacggtggaaattcttgcc
tcgcttcaaaagccaaaaaagatcaccttgaaaggttcagatgggaaatcttacattatg
atgtgtaagcctaaagatgatctaaggaaggactgtcggctcatggaattcaactccctt
attaataagtgcctgaggaaggacgccgagtcccgtcggcgggagctccacatccggacg
tacgcggtgatcccgctgaacgacgagtgtggcatcatcgagtgggtgaacaacactgct
gggctgaggaacatcctcatcaagctctacaaggagaaagggatctacatgactgggaaa
gaattgaggcagcacatgcttcccaagtcagcccctctgcctgaaaagctgaaaatgttc
aaagaagttcttctgcctcgccaccctcctctcttccatgagtggttccttagaacgttt
cccgatcccacttcctggtacaacagcaggtccgcctactgccgctcggtggccgtcatg
tccatggtgggatacatcctggggctgggggaccggcacggcgagaacatcctcttcgac
tccctgaccggggagtgcgtgcacgtggacttcaactgcctcttcaacaagggagaaact
tttgaagtgccagaaatcgtccctttccgcctcactcacaacatggtcaacgggatgggc
cccatggggacagaaggtctcttcagaagagcctgtgaagtcaccatgaggctcatgcgg
gaccagagggagcccctgatgagtgtcttaaagacttttctccatgatcctctggtggaa
tggagtaaacctgttaaagggaacacaagagcccaggtgaacgaaactggagaagttgtc
aatgaaaaggctaaaacccatgtccttgacatagaacagcggttgcaaggagtaattaag
actaggaacagaataaaaggattgcctttatctattgaaggacatgtccattacctcatt
caagaagcaagtgatgacaacctgctctgccagatgtacatgggctgggctccgtatatg
tga

DBGET integrated database retrieval system