KEGG   Empidonax traillii (willow flycatcher): 114069824
Entry
114069824         CDS       T05887                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114069824 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:etl03000]
    114069824 (TP73)
Transcription factors [BR:etl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    114069824 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 114069824
NCBI-ProteinID: XP_027762686
LinkDB
Position
Unknown
AA seq 649 aa
MEAGVVYPLSDSPTAKMSQSPPADEGSTFAHLWSTLEPDSTYFDLPPATHTGSNEVSNQT
EVTMDVFQMRGMSDSVMSQFNLLNNSMDQSIGSRAASTSPYSSEHTSNVPTHSPYSQPSS
TFDAMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIK
VSTPPPPGTIIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDGQSAPASHLIRVEGNNLSQ
YVDDPVTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQV
LGRRSFEGRICACPGRDRKADEDHFREQQALNESAAKNGNANKRTFKQSPQSIPALGTSI
KKRRHGEEEMYYVPVRGRENFEILMKIKESLELVELVPQQLVDSYRQQQQQLLQRQSQLQ
TPSSYGPVLSPMNKVHSGGINKLPSVNQLVGQPAQHGPGTAPSLGPMGPGMLNSHPMQPN
GEMNGGHSSQSMVSGSHCTPPPPYNPDPSLVSFLTGLGCPNCIDYFTSQGLQNIYHLQNL
SIEDLGALKIPEQYRMIIWRGLQELKQGHDYGAQQLIRSSSNASTISIGSSGELQRQRVM
EAVHFRVRHTITIPNRGTADDWADFGFDLPDCKSRKQSIKEEFTEGEIN
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggaagcaggagtggtttatcctctgtcggactcccccactgccaagatgtcccagtca
cctccagccgacgaaggcagcacgttcgcacacctctggagcactctggagccagacagc
acctacttcgacctccctccagccacccacaccggcagcaatgaggtctccaaccagaca
gaggtcacgatggacgtcttccagatgagaggcatgagcgactcggtgatgtcccagttc
aatttgctgaacaacagcatggatcagagcatcggcagcagagcagcctccaccagcccc
tacagctccgagcacacctccaatgtcccaacgcattctccctactcgcagcccagctct
accttcgacgccatgtccccggctcccgtcatcccctccaacaccgactaccccggcccg
caccacttcgaggtgaccttccagcagtccagcaccgccaagtcagccacctggacatac
tcccccctgctgaagaagctctactgtcagatcgccaagacgtgccccatccagatcaag
gtgtccaccccgcctcccccaggcaccattattcgggccatgccggtctacaagaaggca
gagcacgtcaccgaggtggtgaagcgctgccccaaccacgagctcggccgcgacttcaac
gacggccagtcagcccccgccagccacctcatccgggtggaaggcaacaacctgtcccag
tacgtggatgacccggtgacgggccggcagagcgtgatggtgccctacgagcccccgcag
gtggggaccgagttcaccaccatcctgtacaacttcatgtgcaacagcagctgcgtggga
gggatgaacaggaggcccatcctcatcatcatcaccctggagacgagagatgggcaggtc
ctggggaggagatccttcgagggccggatctgtgcctgtcctggcagggaccggaaggcg
gacgaggatcatttccgagagcagcaagccctgaacgagagcgcggccaagaacggcaac
gccaacaagcgcacgttcaagcagagcccccagagcatcccagcgctggggaccagcatt
aagaaacggcggcacggggaggaggagatgtactacgtgcctgttcggggccgggagaac
tttgagatcctgatgaagataaaggagagcctggagctggtggagctggtcccgcagcag
ctggtcgattcctaccggcagcagcagcagcagctcctgcagaggcagagccagctgcag
acaccttcctcctacgggcccgtcctctcacccatgaacaaagtccacagcggaggaatc
aacaagctgccctctgtgaaccagctggtgggacagccagcccagcacggccccggcacc
gcgcccagcctgggccccatggggcctggaatgctgaacagccatcccatgcagcccaat
ggggaaatgaacgggggccactcgtcccagtccatggtgtccgggtcacactgcaccccc
ccgccgccctacaaccccgaccccagcctcgtcagttttttaacaggattggggtgtcca
aactgcatcgactatttcacctcacaagggttacagaatatttaccacctgcagaaccta
tccatagaggatctcggagcactgaagatcccggagcagtacaggatgatcatctggcgg
ggcctgcaggagctcaagcagggccacgactacggggcccagcagctcatccgctccagc
agcaacgcctccaccatctccatcggcagctcaggggagctgcagcggcagcgggtgatg
gaggccgtgcatttccgcgtgcgccacaccatcaccatccccaaccgcggcaccgccgac
gactgggccgacttcggcttcgacctcccggactgcaaatcccgcaaacagtccataaag
gaggagttcacggagggagagatcaactga

DBGET integrated database retrieval system