KEGG   Empidonax traillii (willow flycatcher): 114070060Help
Entry
114070060         CDS       T05887                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A-like with coiled-coils protein 2
Organism
etl  Empidonax traillii (willow flycatcher)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 114070060
NCBI-ProteinID: XP_027763051
LinkDB All DBs
Position
Unknown
AA seq 377 aa AA seqDB search
MIGLGQLREQREAAAVERRREQEFLRRSRIFNARLRTIGIDKDALDVQVKERKIQEAIEK
ARHEKFANDMKRNDRLMCLLEEQQKREIKEQNKALREFQKNQTPETRREFDLNDPQALKK
DRPARVSDTDPRCTISGMQKFAGEDLNYEQRMKFQKEQLREWSLQQQKDWKNALADQKLA
DDLYDKYRVEIDRKILELQRQEEESRRAVCAATKDFNRIQAAELAYKKELDKSQTLRDNM
DEITFLLRGDFLSENPAQALSPLGDRVLVDRWKGMSPEQLMAIRHYQKEQAQENLRMKEQ
ERRRDAEWDRQRVQAARAQILLEREQQRQHRERRRDLDFMNAELSQEQRAKNIYLKEEAY
SNVPTAQYYAQFNTTTR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggctggggcagctgcgggagcagcgggaggcggccgccgtggagcgccggcgg
gagcaggagttcctgcggcggagccgcatcttcaacgcgcggctccgcaccatcgggatt
gataaagatgcattggatgtgcaggtcaaggaaaggaaaattcaagaagcaattgaaaaa
gcacgacatgaaaaatttgctaatgacatgaagaggaatgacaggctgatgtgtctgctg
gaagaacaacagaaaagggaaatcaaggaacagaataaggctctcagggaatttcagaag
aatcagacgccagaaacaagacgcgagtttgacctgaatgatccacaggccctcaagaag
gacagacctgcccgagtttcggacactgaccctcgctgtaccatctctggcatgcagaag
tttgcaggggaagacttaaactatgagcagaggatgaagttccaaaaggagcagctgaga
gagtggtctcttcagcagcagaaagactggaagaatgcattagccgaccaaaaattggca
gatgatctttatgacaagtatagggttgagattgaccgaaagattttggagctccaacga
caagaagaagaaagcaggcgtgctgtctgcgcagccaccaaagatttcaacagaatccag
gctgctgaacttgcttataagaaggagttggacaagtctcaaacactgagagacaacatg
gatgaaattaccttcctgcttcgaggagacttcctttccgaaaaccctgcccaagcactc
agtcccttgggtgaccgcgtgcttgtggatcgctggaaggggatgagcccggagcagctg
atggcaattcgtcactatcagaaggaacaagctcaggagaacctgaggatgaaggagcag
gaacggcggagggacgcggagtgggacaggcagcgcgtgcaggccgcaagagcccagatc
ctgctggagagggagcagcaacggcagcaccgggaacggcgccgggacctggatttcatg
aacgcagagctctcccaggagcagagggcgaagaacatctacctcaaagaagaagcgtat
tccaatgtcccaacagcccagtattacgcccagtttaacacaaccacccgctga

DBGET integrated database retrieval system