KEGG   Empidonax traillii (willow flycatcher): 114070069
Entry
114070069         CDS       T05887                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
etl04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114070069 (PMAIP1)
   04115 p53 signaling pathway
    114070069 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1 Bclx_interact
Other DBs
NCBI-GeneID: 114070069
NCBI-ProteinID: XP_027763067
LinkDB
Position
Unknown
AA seq 68 aa
MLPGKTLRKAAPSASPAGREAAAAECAQELVRIGDRWDLRQRILNLLRKLFCPEMWAARG
HGAQNGRG
NT seq 207 nt   +upstreamnt  +downstreamnt
atgctgcctggcaagaccttgcgcaaagccgcgccatcagcctctcctgcagggcgggag
gcggcggcggccgagtgcgcccaggagctggtccgcatcggcgacaggtgggacctgcgg
cagaggatcctgaatctgctcaggaagctgttctgcccggagatgtgggctgcccgcgga
catggcgcgcagaacggcaggggatga

DBGET integrated database retrieval system