KEGG   Empidonax traillii (willow flycatcher): 114070282
Entry
114070282         CDS       T05887                                 

Gene name
SUFU
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114070282 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 114070282
NCBI-ProteinID: XP_027763414
LinkDB
Position
Unknown
AA seq 485 aa
MEGVRQGGGPPAGGPGSASGSASGSFPSLFPPGLHGIYGECRRLYPDQPNPLQVTAIIKY
WLGGPDPLDYVSMYRNLGNPALNVPEHWHYVSFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHNPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINAQRQNGLNHDRAPSRKDSLESESSAAIIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDTAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVERMLEDLEDLNSPEEFKLPKEYSWPEKKLKVSILPDAVF
DNPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggagggcgtgcggcagggcggggggccccccgcgggtgggccggggtccgcctcgggc
tccgcgtccgggtccttcccgtcgctgttcccgccggggctgcacgggatctacggcgag
tgccgccgcctctaccccgaccagcccaacccgctccaggtcaccgccatcatcaagtac
tggctgggaggacctgaccctctggactatgttagcatgtacagaaacctgggaaatcca
gcgctgaatgttcctgagcactggcactacgtcagctttgggttaagtgacttgtatgga
gacaacagggtacatgagtttacgggaacagatgggccaagtggttttggatttgagctg
acatttcgactgaagagagaaacgggggagtcggcgccgcccacgtggccagcagagctg
atgcagggcttggccagatacgtcttccagtcagaaaacaccttctgcagtggagaccat
gtatcatggcataaccctctggacaacagtgaatctagaatccagcatatgttactgaca
gaagaccctcagatgcagccggtgcaaactccttttggcgtcgttactttcctacagatt
gttggggtctgcacggaggaactgcatgcggctcagcagtggaacggtcaagggatcttg
gaactgcttcggactgtcccagtagctggaggcccctggttgataacagatatgagaaga
ggggagacaatattcgagattgacccacatctgcaacaggagagagtcgacaaagggatt
gagacagatggctcaaacctgagtggagtgagtgccaaatgtgcctgggatgacctcagc
cggccaccggaggatgacgaagacagcaggagcatttgcattgggacgcagccgcggcgg
ctctctgggaaagatacagagcaaatcagggagactttgcggagagggctcgagattaac
agcaaacctgtcctacctccaatcaatgcacaaagacagaacgggttgaaccacgaccga
gcaccaagccgtaaggacagtttagaaagtgagagctcagcagccatcatccctcatgag
ctaatccgcacgagacagctggagagcgtacacctgaaatttaaccaggagtccggagcg
ctcattcccctctgcctaagggggaggctcttacatggacggcactttacatataaaagt
attacaggagatacagcaatcacgtttgtatcaacaggagtagaaggagcctttgctaca
gaggagcacccctatgccgcacatggaccttggttacaaatcctattgaccgaagagttc
gtagagagaatgctggaagatttagaagatctgaattctccagaggaatttaaacttcca
aaggagtacagctggcctgaaaagaaactgaaagtttccatcttgccagatgccgtgttc
gacaacccgctgcattag

DBGET integrated database retrieval system