KEGG   Empidonax traillii (willow flycatcher): 114070460
Entry
114070460         CDS       T05887                                 

Gene name
BTRC
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04114  Oocyte meiosis
etl04120  Ubiquitin mediated proteolysis
etl04218  Cellular senescence
etl04310  Wnt signaling pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114070460 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114070460 (BTRC)
   04340 Hedgehog signaling pathway
    114070460 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114070460 (BTRC)
   04218 Cellular senescence
    114070460 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114070460 (BTRC)
   03036 Chromosome and associated proteins [BR:etl03036]
    114070460 (BTRC)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     114070460 (BTRC)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     114070460 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 114070460
NCBI-ProteinID: XP_027763697
LinkDB
Position
Unknown
AA seq 608 aa
MPKDGFQLISSGYQAWLKQCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALPAFQNSSER
EDCNNDEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLGSTAMKTENCVAKTKLANGTSS
MIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQ
RDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDS
LWRGLSERRGWGQYLFKNKPPDGTAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIH
CRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVII
TGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDIT
LRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDR
LVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAAL
DPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAESTRSPS
RTYTYISR
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgccaaaagatggattccaacttatatcttctggataccaagcatggctaaagcagtgc
tctatgcccagatctctgtggctgggctgctccagcctggcggacagcatgccctcgctg
cgatgcctgtataacccagggactggcgcactcccagctttccagaattcctctgagaga
gaagactgtaataatgatgagccccctaggaagatcattcctgagaagaattcacttaga
cagacctacaacagctgtgccagactgtgcttaaaccaggaaacagtatgtctaggaagc
actgctatgaagactgaaaattgtgtggccaaaacaaaacttgccaatggcacttccagt
atgattgtgcccaagcaaagaaaactgtctgcaagctatgagaaggagaaggaactctgc
gtcaagtattttgaacagtggtctgagtctgaccaggtggagtttgtggagcacctcatc
tcccagatgtgtcactaccagcatggacatataaactcatacctcaaacccatgttacag
cgggacttcatcactgcactgccagctcggggattggatcacattgctgagaacattctg
tcatacctggatgccaaatcgttgtgtgctgccgagctggtgtgcaaggagtggtaccgg
gtgacatcagacggcatgctgtggaagaagctcatcgagagaatggtcaggacagactcc
ctgtggaggggattgtcagagaggagaggatgggggcaatatctatttaaaaataaacct
cctgatggaactgctccacccaactccttctacagagcactttatcccaaaattatacag
gacatagagacaatagagtcaaactggcggtgtggaaggcacagtttacagaggatccac
tgccgaagcgagacaagcaaaggggtttattgtttacagtatgatgatcagaagatagtg
agtggcctacgagacaatactatcaagatctgggataagaatacattggaatgcaagcga
attctcaccggacacacgggttctgtcctgtgcctccagtacgatgaacgggtgatcatt
actggatcttcagactcaacagtcagagtgtgggacgtgaatgcaggtgagatgctgaac
acactgatccaccactgcgaggccgtgctgcacctccgcttcaataatggcatgatggtg
acgtgttccaaagaccgttccatcgccgtgtgggacatggcttctccaacagacatcact
ctgaggagggtgctagtagggcaccgagctgccgtcaacgtagtggactttgatgacaag
tacattgtatcagcatcaggtgacagaactataaaggtatggaacactagtacctgcgaa
tttgtgcgcaccttaaatggccacaaacgaggcattgcatgtctgcagtacagagacagg
ctagtagtgagcggctcttcagataatactatcaggctgtgggatatcgagtgtggggcg
tgtttacgagtactggaaggccatgaagagttggtgagatgcatacgctttgataacaag
aggatagtcagtggggcatatgatgggaaaattaaggtatgggatcttgtggctgctttg
gacccccgtgctccagcagggaccctctgcttgcgaacccttgtggagcattctggaaga
gtctttcgacttcagtttgacgagttccagattgtcagcagctcacacgatgacaccatc
ctcatctgggattttctgaatgacccagctgcccaagcagaatccactcgttccccgtcc
agaacatacacctacatctccagataa

DBGET integrated database retrieval system