KEGG   Empidonax traillii (willow flycatcher): 114070590
Entry
114070590         CDS       T05887                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00512  Mucin type O-glycan biosynthesis
etl00514  Other types of O-glycan biosynthesis
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    114070590 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    114070590 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:etl01003]
    114070590 (GALNT17)
Enzymes [BR:etl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     114070590 (GALNT17)
Glycosyltransferases [BR:etl01003]
 O-Glycan biosynthesis
  Mucin-type
   114070590 (GALNT17)
SSDB
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Other DBs
NCBI-GeneID: 114070590
NCBI-ProteinID: XP_027763893
LinkDB
Position
Unknown
AA seq 541 aa
YLNVFDGWKEQRWVLTEVVFSPGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEK
YGYNSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVN
HTPAHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAA
TGQITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSW
ELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIEL
GIKVWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKWHVYIAW
NLPLENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDV
CLDQGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNGKSRFPQ
LLDCDKVKSSLHKRWSFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFI
K
NT seq 1626 nt   +upstreamnt  +downstreamnt
tatttgaatgtctttgatggctggaaagaacagagatgggttttaacagaggttgttttc
tctccaggtctctccaagtcacttggtctcattgaaggctatggggggcgtgggaagggt
ggccttccagccaccctgtcccctgaggaggaggagaaggccaagggaccccacgagaaa
tatggctacaactcctacctcagtgagaaaatctctctggatcgttccatcccggattat
cggccgaccaagtgcaaagagctgaaatatggtaaggacctgccccagatctccatcatt
ttcatcttcgtgaacgaggcgctgtcggtgatcctgcgctccgtgcacagcgcggtgaac
cacaccccggctcacctcctcaaggagatcatcctcgtggatgacaacagtgatgaagag
gagctgaaggcgccgctcgaggagtacgtgaacaagaggtacccggggctggtgaaggtc
gtgcgcaaccagaagagggaagggctgatccgagcccggatcgaaggctggaaagctgcc
acgggccagatcacgggatttttcgatgcccacgtggagttcactgctggctgggccgag
ccggtgctttcccggatccaggagaaccggaagagggtcatcctgccctccattgacaac
atcaagcaggacaacttcgaggtgcagcgctacgagaactctgcccacgggtacagctgg
gagctgtggtgcatgtacatcagcccccccaaggactggtgggacgctggggacccctcc
ctgcccatcaggaccccagccatgatcggctgctccttcgtggtgaacaggaagttcttc
ggggagatcgggctcctggaccccggcatggacgtgtacggaggggagaacatcgagctg
ggcatcaaggtgtggctgtgtgggggcagcatggaggtcctgccctgctccagggtggcc
cacatcgagcgcaagaagaagccctacaacaacaacatcgggttctacaccaagcgcaac
gcgctgcgcgtggccgaggtgtggatggacgactacaagtggcacgtctacatcgcctgg
aacctgcccctggagaatccagggattgacatcggggatgtttcggagagaaaagcgtta
aggaagagcctgaagtgcaaaaatttccagtggtacctggaccatgtttatccagaaatg
aggagatacaacaacaccattgcttatggagagctccgaaacaacaaggccaaggacgtg
tgcctggaccagggccctcaggagaaccacacagcaatactgtacccctgccacggctgg
gggcctcagctggcacgttacaccaaggaggggttccttcacctgggcgccctgggaacc
accacccttctcccggacacgcggtgcctggtggataacgggaagagccgcttcccgcag
ctcctggactgcgacaaggtcaagagcagcctccacaagcgctggagtttcatccagaac
ggtgccatcctgaacaagggcacagggaggtgcctggaagtggagaacaggggaatggct
gggattgatctgatccttcgcagctgcacaggacaaaggtggacaattaaaaatttcatc
aagtaa

DBGET integrated database retrieval system