KEGG   Empidonax traillii (willow flycatcher): 114070738
Entry
114070738         CDS       T05887                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04060  Cytokine-cytokine receptor interaction
etl04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114070738 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    114070738 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:etl04052]
    114070738 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:etl00536]
    114070738 (IL4)
Cytokines and growth factors [BR:etl04052]
 Cytokines
  Interleukins
   114070738 (IL4)
Glycosaminoglycan binding proteins [BR:etl00536]
 Heparan sulfate / Haparin
  Cytokines
   114070738 (IL4)
SSDB
Motif
Pfam: IL4 Zn_Tnp_IS1
Other DBs
NCBI-GeneID: 114070738
NCBI-ProteinID: XP_027764104
LinkDB
Position
Unknown
AA seq 140 aa
MSILARVLLPFLALLACQGDVVSPWTHTLRTNMLRESIRRLHQLQHTQVSCNEMNVTDIF
ADSKHGDTMELLCKAATVAREGWSCHRHLEGIYTNLLGLLRGHRLEHQAPCPVAAGSTTS
LRSFLKELHQVLQEKYKNQK
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagcatcctggcccgggtgctgctgcccttcctggcgctgctggcctgccagggtgac
gtggtcagtccctggacacacacgctgcggacaaacatgctgagggagagcatcaggcgg
ctgcaccagctccagcacacacaggtttcctgtaacgagatgaacgtgaccgatattttt
gcagacagtaagcacggtgacaccatggagctcctgtgcaaagctgccaccgtggctcgg
gaaggctggagctgccacaggcacctcgagggcatctacaccaacctgctgggcctgctc
cgggggcacaggctggagcaccaggcaccctgtcctgtggcagcaggtagcaccacctca
ctcaggagtttcctcaaggaattgcaccaagtccttcaagaaaaatacaagaatcagaag
tga

DBGET integrated database retrieval system