KEGG   Empidonax traillii (willow flycatcher): 114070741
Entry
114070741         CDS       T05887                                 

Gene name
KIF3A
Definition
(RefSeq) kinesin-like protein KIF3A isoform X1
  KO
K10394  kinesin family member 3A
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114070741 (KIF3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:etl04812]
    114070741 (KIF3A)
Cytoskeleton proteins [BR:etl04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     114070741 (KIF3A)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF812
Other DBs
NCBI-GeneID: 114070741
NCBI-ProteinID: XP_027764106
LinkDB
Position
Unknown
AA seq 730 aa
MPINRPEKLDRPESCDNVKVVVRCRPLNEREKATGYKMAVNVDEMRGTITVHKTDSSNEP
PKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAVP
ELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDV
GVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDG
NMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPY
RNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKD
AMLRQFQKEIEELKKKLEEGEEISGSETSDSEEEDEDDDGEIGEDGEKRKKRRGSSSSSS
SDSTCSVIEKPLDKSFTNQAGKKKVSPDKMVEMQAKIEEERKALETKLDMEEEERNKARA
ELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRK
RAEQLRKELEEKEQERLDIEEKYTNLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQR
EIEGLLENIRQLSRELRLQMLIIDNFIPPDYQEMIENYVHWNEDIGEWQLKCVAYTGNNM
RKQTPVLDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGRSRPKTGRRKRSAK
PGAVIDSLLQ
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgccgatcaacaggcctgagaagctggacaggcctgagagctgtgacaatgtcaaggtg
gtggttcggtgccggcccctcaacgagcgcgagaaagccacgggctacaaaatggctgtg
aacgtggatgagatgagagggaccataactgtgcataaaacagactcctccaacgagcct
cccaagacatttacatttgacacagtgtttggaccagagagtaaacagctggatgtctat
aatttaactgcaagacctatcattgactctgtcctagagggatacaatggtactattttt
gcatatgggcagactggaacaggcaagactttcaccatggaaggggtccgagcagttcct
gagctcagaggcatcattcccaattcctttgctcatatattcggtcacattgccaaggca
gagggggacacaaggttcttagttcgtgtctcttacctggagatttacaatgaggaggtg
cgggacctgctgggaaaggaccagacacagaggttggaggttaaagagagacctgatgtg
ggagtttatatcaaagacctctcagcttatgtcgtaaacaatgcagatgatatggacagg
atcatgactctgggccacaagaaccgttctgttggtgccacaaacatgaacgagcacagc
tctcgctcccacgccatcttcaccatcaccatcgagtgcagcgagaagggcgtggatggc
aacatgcacgtgcgcatgggcaagctgcacctcgtggatctggctggctctgaaagacag
acaaaaactggagccacagggcagcgactgaaggaagccaccaagatcaacctgtccctt
tccaccctggggaatgtcatctctgcgctggtggatggcaagagcacccacgtgccctac
cggaattccaaactgacacggctcctccaggactccctggggggcaactccaaaaccatg
atgtgtgcaaacatcggcccggcagactacaactacgacgagaccatcagcaccctcagg
tatgcaaacagagccaagaacatcaagaacaaggccaggattaacgaggatcccaaggat
gcaatgctccgccagttccagaaggaaattgaagagcttaagaaaaaactggaggaaggg
gaagagatatctggttctgagaccagtgattctgaagaggaggacgaagatgacgatggg
gagattggagaggacggggagaagcggaagaaacggcggggcagtagcagcagcagtagt
tcagactccacatgctctgtcatagagaaacctctggataagtccttcactaatcaagca
ggcaaaaagaaagtttcccctgataagatggtagagatgcaagcaaagattgaagaggag
agaaaagctcttgaaactaagcttgatatggaagaagaagaaagaaataaagccagagct
gaactggagaagagagaaaaagacttgcttaaagctcagcaggagcaccagtccctgctg
gagaaactctctgcactggagaagaaggttatcgtgggaggagtggacttgctggcaaaa
gcagaggagcaagaaaagctgctggaagaatccaacatggaactggaggaacgaaggaag
agagcagagcagctgcgcaaggagctggaggagaaggagcaagagcgcttggacattgag
gagaagtacaccaacctccaggaggaagcacaggggaaaaccaaaaagctgaagaaagtc
tggaccatgctcatggctgcaaaatcagagatggcagatctgcaacaagagcatcagagg
gagatcgaagggttgctggagaacattcggcagctgagcagggagctccgtctgcagatg
ctcatcatagacaacttcattcctccggactaccaggaaatgattgaaaactacgttcac
tggaacgaagacataggagagtggcagctgaaatgtgttgcatatacaggaaacaatatg
aggaaacagacacccgtcctggataaaaaagagaaagatccctttgaagtggacctttcc
catgtttacttagcttacactgaagaaagcttgaggcagtccctgatgaagctggagagg
ccgaggacttcgaaaggaagatccaggcccaagacgggtagaagaaaacgttcggccaag
ccaggagctgtcattgactccctgctgcagtag

DBGET integrated database retrieval system