KEGG   Empidonax traillii (willow flycatcher): 114070800
Entry
114070800         CDS       T05887                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04068  FoxO signaling pathway
etl04110  Cell cycle
etl04114  Oocyte meiosis
etl04115  p53 signaling pathway
etl04218  Cellular senescence
etl04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114070800 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114070800 (CDK2)
   04114 Oocyte meiosis
    114070800 (CDK2)
   04115 p53 signaling pathway
    114070800 (CDK2)
   04218 Cellular senescence
    114070800 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    114070800 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etl01001]
    114070800 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:etl03032]
    114070800 (CDK2)
   03036 Chromosome and associated proteins [BR:etl03036]
    114070800 (CDK2)
Enzymes [BR:etl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     114070800 (CDK2)
Protein kinases [BR:etl01001]
 Serine/threonine kinases: CMGC group
  CDK family
   114070800 (CDK2)
DNA replication proteins [BR:etl03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    114070800 (CDK2)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    114070800 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase
Other DBs
NCBI-GeneID: 114070800
NCBI-ProteinID: XP_027764188
LinkDB
Position
Unknown
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKARNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDSSSLSGIALPLIKSYLFQLLQGLAFCHA
HRVLHRDLKPQNLLINADGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEAAWPGVSAMPDYKPSF
PKWARQDFGKVVPPLDEEGRKLLAQMLHYDPNKRISAKAALGHPFFQDVTRAVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccagaaggtggagaagatcggggagggcacctacggcgtggtgtacaag
gcccggaacaaggtgacaggggaggtggtggcactcaagaagatccgcctggacacggag
accgagggtgtccccagcacggccatccgggagatctccctgctcaaggagctcaaccac
cccaacatcgtcaagctcctggacgtgatccacacggagaacaagctctacctggtcttc
gagttcctgcaccaggacctgaagaagttcatggactcttcgtccctcagtggcatcgct
ctgcccctcatcaagagttacctgttccagctgctgcagggcctggcgttctgccacgcc
caccgggtgctgcaccgcgacctcaaaccgcagaacctgctcatcaacgccgacggcgcc
atcaaactggccgacttcgggctggcccgcgccttcggggtgcccgtgcgcacctacacc
cacgaggtggtgaccctgtggtaccgagcccccgagatcctactgggctgcaagtactac
tcgacagccgtggacatctggagcctgggctgcatcttcgctgagatgatcacccgccgt
gccctgttcccgggggactcggagatcgaccaactcttccgaattttccgtaccctgggg
acccccgacgaggctgcctggccaggggtctcggccatgcccgactacaagcccagcttc
ccgaaatgggcccggcaggacttcggcaaagtggtgcctccactggacgaggaggggcgg
aagctgctggcgcaaatgctgcactatgaccccaacaagaggatctcggccaaggcggcg
ctgggacacccctttttccaggatgtcacccgagcagtccctcacctgcgcctctga

DBGET integrated database retrieval system