KEGG   Empidonax traillii (willow flycatcher): 114071466
Entry
114071466         CDS       T05887                                 

Definition
(RefSeq) uncharacterized protein C18orf25-like
Organism
etl  Empidonax traillii (willow flycatcher)
SSDB
Motif
Pfam: RNF111_N
Other DBs
NCBI-GeneID: 114071466
NCBI-ProteinID: XP_027765100
LinkDB
Position
Unknown
AA seq 300 aa
MKMEAVGKAELVDSELPPKTSEKQETAPHECGSIELGTQTQKDNVHTAADSVVLSSMPCL
LMELRRDSSEFQLASTESDKPTDGRVYESDSSNHCMLSPSSSGHLADSDTLSSTEENEPC
QAQAAVGGHLSAVSGAAVGRKSRRSRSESETSTMAAKKNRQSSNKQNGRITKAKGHRSQK
HKERIRLLRQKREAAARKKYNLLQDSSTSDSDLTCDSSTGSSDDDEVSRSSKTITAEIPD
GPPVVAHYDISDTNSDPEVVNVDHLLAAAVVQEHNNSLGNQDSVSTWRTRGLLDELSADT
NT seq 901 nt   +upstreamnt  +downstreamnt
atgaagatggaggcagtgggaaaagcagaacttgttgattcagaacttccaccaaagact
tctgaaaagcaagagactgctcctcatgaatgtggatctatagaacttgggacacaaact
cagaaagacaatgtgcacactgcagcagactctgtggtgctctcttcaatgccttgctta
ctgatggaactgaggcgagactcttcagagtttcaactggcatctacagagagtgataag
ccaacggatggtcgagtttatgagagtgactcttctaaccattgcatgctttcgccttct
tccagtgggcatttggctgactctgatacattgtcttccacagaagagaatgaaccttgt
caagctcaagctgctgtagggggacacctttctgcagtgtctggtgctgcagttgggagg
aaatccaggagatccaggtctgaaagtgaaacttcaacaatggctgccaagaaaaacaga
cagtctagtaataaacagaatggtagaattaccaaagcaaagggtcatcgaagccaaaag
cacaaagaaagaatccggctcttgagacagaaacgggaggcagctgctcgcaagaagtac
aacctgctgcaggacagcagtaccagtgatagtgacctgacgtgtgactcaagcacgggt
tcatcagatgatgatgaagtttcaaggagcagcaagacaatcactgcagagataccagat
ggacctccagttgtagctcactatgatatatcagacacaaactcagacccagaagtggta
aatgtggaccatctgttggcagctgcagtagttcaagagcacaataattctttaggaaat
caagactcagtatctacctggagaaccagaggactgctagatgaactgagtgctgataca
g

DBGET integrated database retrieval system