KEGG   Empidonax traillii (willow flycatcher): 114072973
Entry
114072973         CDS       T05887                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04080  Neuroactive ligand-receptor interaction
etl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114072973 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114072973 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:etl04030]
    114072973 (LPAR2)
G protein-coupled receptors [BR:etl04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    114072973 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 114072973
NCBI-ProteinID: XP_027766583
LinkDB
Position
Unknown
AA seq 257 aa
MRHCFYNETVGFFYNNSRKELTTYWRTKDVLVVALGLSVSVIVLLTNLLVITAIVINRRF
HYPIYYLLGNLAAADLFAGVAYMFLMFHTGPRTAGLSLKTWFIRQSLLDTSLTASVVNLL
AIAVERHQTVFTMQLHSKMSNQRVTVLIFCIWATALLLGLIPSYGWHCLCALDQCSSMAP
LYSRSYLTFWAVSNLVIFLVMVLVYTHIFVYVKRKMTRMSKHTSFHPRYRETMISLVKTV
TIILSESPLGSSAARLG
NT seq 772 nt   +upstreamnt  +downstreamnt
atgaggcactgcttctacaacgagaccgtgggcttcttctacaacaactcccgcaaggag
ctgaccacgtactggcgcaccaaggacgtgctggtggtggccctgggcctgagcgtcagc
gtcatcgtgctgctgaccaacctgctggtcatcacggccatcgtcatcaaccgccgcttc
cactaccccatctactacctgctgggcaacctggcggccgccgacctgttcgccggcgtg
gcctacatgttcctcatgttccacacggggccccgcacggccgggctgtccctcaagacc
tggttcatccggcagagcctgctggacaccagcctgacggcctcggtggtcaacctgctg
gccatcgccgtggagcggcaccagacggtgttcaccatgcagctgcacagcaagatgtcc
aaccagcgcgtcaccgtgctcatcttctgcatctgggccacggcgctgctgctggggctc
atcccctcctacggctggcactgcctgtgcgcgctggaccagtgctccagcatggccccc
ctctacagcaggagctacctgaccttctgggccgtctccaacctcgtcatcttcctcgtc
atggtgctggtctacacccacatcttcgtctacgtcaagaggaagatgacgcgcatgtcc
aagcacaccagcttccacccccgctacagggagaccatgatcagcctggtcaagacggtc
accatcatcctcagtgagtcccccctgggatcctcagcggcccggctggggg

DBGET integrated database retrieval system