KEGG   Empidonax traillii (willow flycatcher): 114073337
Entry
114073337         CDS       T05887                                 

Definition
(RefSeq) protein reprimo-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114073337
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 114073337
NCBI-ProteinID: XP_027766912
LinkDB
Position
Unknown
AA seq 125 aa
MNGSSAGLPGALGGAAGLQGGPNGSSAAAGLLAGAGGAALELERALRCCTAASVVTDGSG
AAEERSLYIMRVVQIAVMCVLALTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAV
VVGPY
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaacggctcctcggcggggctcccgggagcgctcggcggggccgcggggctgcaggga
gggccgaacggctcctcggcggccgcggggctgctggcgggggccgggggagcggcgctg
gagctggagcgggcgctgcgctgctgcaccgccgcctccgtggtgaccgacggcagcggc
gcggccgaggagcgcagcctgtacatcatgcgggtcgtgcagatcgccgtcatgtgcgtc
ctcgccctcaccgtcgtcttcggcatcttcttcctcggctgcaacctgctcatcaagtcc
gaggggatgatcaacttcctggtgaaggaccgccggccgtccaaggaggtggaggcggtg
gtggtggggccgtactga

DBGET integrated database retrieval system