KEGG   Edwardsiella tarda EIB202: ETAE_0168Help
Entry
ETAE_0168         CDS       T01121                                 

Gene name
tuf1
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
etr  Edwardsiella tarda EIB202
Brite
KEGG Orthology (KO) [BR:etr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:etr03012]
    ETAE_0168 (tuf1)
   03029 Mitochondrial biogenesis [BR:etr03029]
    ETAE_0168 (tuf1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etr04147]
    ETAE_0168 (tuf1)
Translation factors [BR:etr03012]
 Eukaryotic Type
  Elongation factors
   ETAE_0168 (tuf1)
 Prokaryotic Type
   ETAE_0168 (tuf1)
Mitochondrial biogenesis [BR:etr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ETAE_0168 (tuf1)
Exosome [BR:etr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ETAE_0168 (tuf1)
  Exosomal proteins of breast cancer cells
   ETAE_0168 (tuf1)
  Exosomal proteins of colorectal cancer cells
   ETAE_0168 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ACY83015
UniProt: D0Z9S5
LinkDB All DBs
Position
180031..181215
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIIELAETLDSYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
DEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIT
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgttcaaaaccgcacgttaacgtcggtactatcggccac
gttgaccacggtaaaactaccctgaccgctgctatcaccaccgttctggctaaaacctac
ggcggtagcgctcgcgcattcgatcagatcgataacgcgccggaagaaaaagcacgtggt
atcaccatcaacacctctcacgttgaatacgataccccgacccgtcactacgctcacgta
gactgcccggggcacgccgactatgttaaaaacatgatcacgggtgctgcgcagatggac
ggcgcaatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgccaggtaggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgagctgctgtctcag
tacgacttcccgggcgacgatacgccggtaatccgcggttctgcgctgaaagcgctggaa
ggcgaagccgagtgggaagctaagatcatcgaactggctgaaactctggactcctacatc
ccggaacctgagcgtgacatcgacaagccgttcctgctgccgatcgaagacgtattctct
atctctggccgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaggtaggt
gacgaagttgaaatcgttggtatcaaagcgacgaccaaaaccacctgtaccggcgtggaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggcgtactgctgcgt
ggtaccaagcgtgacgaaatcgaacgtggtcaggtactggctaagccgggctccatcact
ccgcacaccaagttcgaatcagaagtgtacatcctgagcaaggatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtaacgggc
accatcgaactgccggaaggtgtagagatggtcatgccgggcgacaacatcaagatggtt
gttaccctgatccacccgatcgccatggacgatggtctgcgcttcgcaatccgcgaaggc
ggccgtaccgttggtgcgggcgttgttgctaaagttatcgaataa

DBGET integrated database retrieval system