Edwardsiella tarda EIB202: ETAE_0836 Help Entry ETAE_0836         CDS       T01121                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism etr  Edwardsiella tarda EIB202 Pathway etr01100   Metabolic pathways etr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:etr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ETAE_0836   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ETAE_0836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Lmo2446_N_CBM-like Motif Other DBs NCBI-ProteinID:  ACY83681 LinkDB All DBs Position complement(923645..923902) Genome browser AA seq 85 aa AA seqDB search MQELYLEIKNLIINTLNLDELSTDDIDTDAALFGDGLGLDSIDALELGLAVKNQYGIILS AESEEMRQHFYSVATLAAFIHSQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagagctttaccttgaaattaaaaatctcattattaacacgttaaatctggacgag ctgagcaccgatgacatcgacaccgatgccgcgctgttcggggatggattaggtctggac tctatcgacgcattagagctgggtctggcggtgaaaaatcagtacggcatcatcttgtcc gccgagagtgaagagatgcgtcagcacttctactccgtggcgacgctggccgcttttatt cactcacaacgcgcctga

DBGET integrated database retrieval system