KEGG   Edwardsiella tarda EIB202: ETAE_1447Help
Entry
ETAE_1447         CDS       T01121                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00010  Glycolysis / Gluconeogenesis
etr00230  Purine metabolism
etr00620  Pyruvate metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr01130  Biosynthesis of antibiotics
etr01200  Carbon metabolism
etr01230  Biosynthesis of amino acids
Module
etr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etr_M00002  Glycolysis, core module involving three-carbon compounds
etr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
etr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_1447
   00620 Pyruvate metabolism
    ETAE_1447
  Nucleotide metabolism
   00230 Purine metabolism
    ETAE_1447
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     ETAE_1447
Membrane trafficking [BR:etr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ETAE_1447
Exosome [BR:etr04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAE_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C DUF3006
Motif
Other DBs
NCBI-ProteinID: ACY84288
UniProt: D0ZH12
LinkDB All DBs
Position
complement(1558526..1559968)
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKIISAGANVMRLNFSHGTPEDHQLRANKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKVFLNVGDKFLLDATLDKGEGDKEKVGIDYKRLPED
VVPGDILLLDDGRVQLKVLSVQEDKVFTEVTVGGPLSNNKGINKLGGGLSADALTEKDKA
DILTAAKIGVDYLAVSFPRCGEDLNYARRLARDAGCEAKIVAKVERAEAVASDEAMDDVI
LAADVVMVARGDLGVEIGDPELVGIQKKLIRRARKLNRVVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPAETVAAMARVCLGAEKIPSINISKHRLDAQFDN
TEEAVAMSAMYAANHLKGVTAIIAMTESGRTALMMSRISSGLPIFAMSRHERTLNLTALY
RGVTPVHFDSHTDGVAAAQAAANLLRDKGFLVSGDLVIVTQGDQMDTIGSTNTCRTLRVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacggctcagaagaaccaaaatcgttaccacgcttggcccggctaccgatcgc
gacaataatctggaaaagattatctccgccggcgccaacgtgatgcgtcttaacttttca
cacggcacgccggaagatcaccagctgcgcgccaacaaagtccgtgaaatcgccgccaaa
ctcggtcgtcatgtcgccattctcggggacctgcagggtcctaaaatccgggtatccacc
tttaaggaaggtaaagttttcctcaacgttggggataaattcctgctggatgccacgctg
gacaagggcgaaggcgataaagagaaagtgggcatcgactataagcggctgccggaagat
gtggtgccgggcgatattctgctgctcgacgatggccgtgttcagctgaaggtgctctcc
gtacaggaagataaggtgttcaccgaggtcaccgtcggcggcccgctgtccaacaataaa
gggatcaacaagctgggcggcgggctctctgccgatgccctgacggaaaaggacaaggcc
gatatcctgaccgccgccaagatcggtgtcgactatctggccgtctccttcccgcgctgc
ggggaagatctcaactatgcccgtcgtctggcgcgcgatgccggctgcgaagccaagatc
gtcgctaaggtcgagcgtgccgaggccgttgccagcgacgaagcgatggatgatgtgatc
ctggccgccgacgtcgtgatggtcgcccgcggcgatctgggggttgaaatcggcgatccg
gagctggtcgggatccagaaaaagctgatccgccgcgcccgcaagctgaaccgcgtcgtg
atcaccgcgacccagatgatggagtccatgatcaccaacccgatgccgacccgtgcggag
gtcatggacgtggccaacgccgtactggacggtaccgatgccgtgatgctgtctgccgag
accgccgcgggccagtacccggccgaaaccgtggccgccatggcgcgcgtctgcctgggc
gccgagaagatccccagcatcaatatctccaagcaccgccttgatgcccagttcgacaat
acggaagaagcggtcgccatgtccgccatgtacgccgccaaccacctcaagggggtaacg
gccatcattgcgatgacggagtccggacgcaccgcgctgatgatgtcccggatcagctct
ggcctgccgatcttcgccatgtcccgccatgagcgcaccctgaacctgacggccctgtac
cgcggcgtcacgccggtgcactttgacagccacaccgacggcgtggccgcggcccaggcg
gcggcgaatctgctgcgggataaaggcttcctggtctccggcgatctggtgatcgtcaca
cagggcgatcagatggacaccatcggcagcaccaacacctgccgtaccctgcgcgtagag
taa

DBGET integrated database retrieval system