KEGG   Edwardsiella tarda EIB202: ETAE_1999Help
Entry
ETAE_1999         CDS       T01121                                 

Gene name
cbiT
Definition
(GenBank) cobalt-precorrin-6Y C(15)-methyltransferase
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00860  Porphyrin and chlorophyll metabolism
etr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAE_1999 (cbiT)
Enzymes [BR:etr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     ETAE_1999 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS PCMT Methyltransf_31 PrmA GidB Cons_hypoth95 Methyltransf_25 Methyltransf_4 Met_10 Methyltransf_12 Methyltransf_11 Methyltransf_15 CMAS Methyltransf_18 Methyltransf_2 Methyltransf_23 DOT1 Methyltr_RsmB-F PRMT5 RrnaAD Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: ACY84836
UniProt: D0Z8T7
LinkDB All DBs
Position
complement(2109526..2110095)
Genome map
AA seq 189 aa AA seqDB search
MNDELFLRGETVPMTKEAVRALALSKLALHRARHLIDIGAGTGSVSIEAALQFPSLRVTA
IEKNPAALRLLAENCRRFACDNVSILPGTAPMPVAARADAVFMGGSGGHLTALMDWSMAQ
LHPGGRLVMTFILMENLHSALAYLAQRGAQGVTCQQIQTASWVPLGKGHYFKPNNPVFVI
ACQKEEHHV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgagctttttctgcgcggcgaaacggtgccgatgaccaaagaggcggtgcgc
gcgctggccctcagcaaacttgcgctgcaccgagcccgccatctgattgatatcggggcg
ggaaccggcagcgtgtcgattgaggccgcgctgcagtttccctccctgcgggtgaccgcc
atcgagaaaaaccccgcggcgctgcgcctgctggcggaaaattgccggcgctttgcctgc
gacaacgtcagcattctgcccggcaccgcgccgatgccggtggcggcgcgggccgacgcc
gtgtttatgggcggcagcggcggccacctgacggcgctgatggactggtccatggcgcag
ctgcatcccggcgggcgcctggtgatgacctttatcctgatggagaacctgcatagcgcg
ctggcctacctggcgcagcggggagcgcagggcgtgacgtgccagcagatacagacggcg
tcgtgggttccgctcggcaagggccactactttaaaccgaataatcccgtttttgttatc
gcctgtcagaaggaggagcatcatgtctga

DBGET integrated database retrieval system