KEGG   Edwardsiella tarda EIB202: ETAE_2868Help
Entry
ETAE_2868         CDS       T01121                                 

Gene name
gadB2
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00250  Alanine, aspartate and glutamate metabolism
etr00410  beta-Alanine metabolism
etr00430  Taurine and hypotaurine metabolism
etr00650  Butanoate metabolism
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01120  Microbial metabolism in diverse environments
etr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:etr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ETAE_2868 (gadB2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAE_2868 (gadB2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ETAE_2868 (gadB2)
   00430 Taurine and hypotaurine metabolism
    ETAE_2868 (gadB2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAE_2868 (gadB2)
Enzymes [BR:etr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ETAE_2868 (gadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Arabinose_Iso_C PRTase_3
Motif
Other DBs
NCBI-ProteinID: ACY85701
UniProt: D0ZDS2
LinkDB All DBs
Position
complement(3017456..3018850)
Genome map
AA seq 464 aa AA seqDB search
MKKGTDTRGGYLDSRFGSEAIRTAAEAHHFPQGEMREDIAFQVINDELFLDGNARQNLAT
FCQTWDDDYVHRLMDISINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPRPADGQAVGTN
TIGSSEACMLGGMAMKWRWRAKRLAQGKSVDKPNMVCGPVQVCWHKFARYWDVELREIPM
APGKLFMDPERMIAACDENTIGVVPTFGVTYTGNYEMPDVLHKALDDLQARTGLDIDMHV
DAASGGFLAPFCAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVVWRDAASLPDDLIFK
VDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVHTASYQVAQFLAAEIAKLGP
YEFICSGDPQQGIPAVCFRIPAGKALGYSLYDLSERLRLRGWQVPAFALNGEMSDVVVMR
IMCRRGFEMDFAQLLMEDFRAALAYLKAHPAVANVAHQNSFKHS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtactgatacccgtgggggatatttggattcccgctttggttcagaggct
attcgcacggcggcagaggcacaccattttcctcagggagaaatgcgcgaagacattgct
ttccaggttattaacgatgagctgtttttagacggcaatgcccggcaaaacctggcgacg
ttttgtcagacctgggatgacgactatgtacaccgcctgatggatatttcgatcaataaa
aactggatcgataaagaggagtatccgcagtcggcggcgatcgatctgcgctgcgtcaat
atggtggccgatctgtggcatgcgccgcgcccggcggatggacaggccgtcggtaccaat
actatcggctcctccgaggcctgcatgctgggcggcatggcgatgaagtggcgctggcgc
gccaagcgtctggcgcagggaaaatcggtggataagcccaacatggtgtgcgggccggta
caggtctgctggcataagtttgcccgctactgggatgtcgaactgcgcgagatcccgatg
gcgcccggcaagctgtttatggatccggagcggatgatcgccgcctgcgatgagaacacc
atcggcgtcgtgccgacctttggcgttacctacaccggtaactatgagatgcctgacgtg
ctgcacaaggcgctggacgatctgcaggcgcgtaccgggctggatatcgacatgcacgtc
gacgccgccagcggcggcttcctggcaccgttctgcgccccggatatcgtctgggacttc
cgtctgccgcgggtgaaatccatcagcgcatccggccataagttcggcctggcgccgctc
ggctgcggctgggtggtgtggcgtgacgccgcctctttaccggacgatctgatctttaag
gtggactatctgggcggacaggttggcacctttgccattaacttctcccgtcccgcgggt
caggtgatcgcgcagtactatgaattcctgcgtctgggacgcgagggctacaccaaggtg
cataccgccagctatcaggtggcgcagttcctggcggcggagatcgctaagctgggaccc
tatgagtttatctgcagcggcgatccgcagcagggtattccggcggtgtgcttccgcatt
ccggctggcaaggcgctgggctatagcctgtacgatctctccgagcgcctgcgcctgcgc
ggctggcaggttccggcctttgcgttgaacggtgaaatgtccgacgtggtggtgatgcgc
atcatgtgccgccgcggctttgagatggattttgcccagctgctgatggaggacttccgc
gcggcgctggcctatcttaaggcccatccggcagtggccaatgtggcgcatcagaacagc
ttcaaacattcctga

DBGET integrated database retrieval system