KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0868
Entry
ECSP_0868         CDS       T00949                                 

Gene name
nleD
Definition
(GenBank) non-LEE-encoded type III secreted effector
  KO
K23656  T3SS secreted effector NleD
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:etw00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECSP_0868 (nleD)
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: ACT70727
LinkDB
Position
933552..934250
AA seq 232 aa
MRPTSLNLVLHQSSRSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRAESQKYSPLLLEEARTVG
LGAFSEEVLSENKFHEEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaaggtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgagcagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaggaggtgctttcagaaaataaattccacgaagagattgggatg
ccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system