KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_0939Help
Entry
ECSP_0939         CDS       T00949                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 6a)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00550  Peptidoglycan biosynthesis
etw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECSP_0939 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etw01002]
    ECSP_0939 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:etw01011]
    ECSP_0939 (dacC)
Enzymes [BR:etw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECSP_0939 (dacC)
Peptidases and inhibitors [BR:etw01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ECSP_0939 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:etw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECSP_0939 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACT70796
LinkDB All DBs
Structure
PDB: 

Position
1010970..1012172
Genome map
AA seq 400 aa AA seqDB search
MTQYSSLLRGLAAGSAFLFLFAPTAFAAEQTVEAPSVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLIVMENVEEGGFFGRMWDFVMMKFHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatactcctctctccttcgtggtcttgcagcgggttctgcatttttattcctt
tttgccccaacggcattcgcggccgaacaaaccgttgaagcgccgagcgtggatgcgcgt
gcatggattttaatggattacgccagcggtaaagtgctggcagaaggcaatgcggatgag
aaactggatcccgcgagcctgactaaaatcatgaccagctatgtggttgggcaggcgctt
aaggccgataagattaaactcaccgatatggtgacggtcggtaaagatgcctgggcgacg
ggaaatccggcactgcgtggttcatcggtaatgttcctcaaaccgggcgatcaggtttcg
gtggcagacttgaacaaaggtgtgattatccagtccggtaatgacgcctgtattgcgctg
gccgattacgttgccgggagccaggagtcatttattggtttgatgaatggttatgccaaa
aaactggggctgaccaacactaccttccagacggtgcacggtctggatgcgccggggcag
ttcagtaccgcgcgcgatatggcattgctgggtaaagcattgatccacgatgtgccggaa
gagtacgccattcataaagagaaagagttcaccttcaacaaaattcgtcagcctaaccgt
aaccgtctgctgtggagcagcaatctgaatgttgatggcatgaagacaggaaccacggca
ggcgcgggatataatctggttgcttcggctacccagggcgatatgcgtttaatctccgta
gtgctgggggcgaaaaccgaccgtatccgttttaatgagtctgagaaattattgacctgg
ggtttccgcttctttgaaaccgtgacgccaattaaacctgatgccacctttgtgactcag
cgcgtctggtttggtgataagagcgaagtgaatctcggggcaggcgaagcgggctcagtg
accataccgcgtgggcagctgaaaaacctgaaggcgagctacacgttaacggaaccgcag
cttaccgcaccgctgaaaaaaggtcaggttgtcgggaccattgatttccagcttaacggt
aaatccattgagcagcgtccgctgatcgtgatggaaaatgtggaagagggcggattcttt
ggtcggatgtgggatttcgtgatgatgaaattccatcagtggttcggcagctggttctct
taa

DBGET integrated database retrieval system