KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_1133Help
Entry
ECSP_1133         CDS       T00949                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
Enzymes [BR:etw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECSP_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ACT70983
LinkDB All DBs
Position
complement(1207855..1208514)
Genome map
AA seq 219 aa AA seqDB search
MFLSIGIINRSDRILHSYCAISSERCLLPCNQQAQSVNGINEGFMKCKIIAAIAMLTAAS
CGYAAEQEVPMNLVSADGKEVSIGKITIQETPYGLLFTPALHSLSEGIHGFHVHEKGNCA
PALKDGKPVAALSAGGHFDPKNTGKHLGPWSPDGHLGDLPALFVTHDGKANYPVLAPRLN
SLKEIKGRSLMLHAGGDNHHDHPEPLGGGGARMACGIIQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctcaattggtattattaatcgcagtgataggatattgcacagctattgcgcg
atatcatcagaacgctgtttgttaccctgtaaccagcaagctcagtctgttaacggaatt
aatgagggttttatgaaatgtaaaatcattgctgccattgccatgctgacagcagcatca
tgcggatacgcagcagaacaggaagtcccaatgaaccttgtcagtgctgacggaaaagaa
gtcagcattggaaaaataaccattcaggagaccccctacggtctgctgttcacaccagcc
cttcactctctgtctgaaggcattcatggttttcatgtgcacgaaaaaggaaattgcgcc
ccggcactgaaagacggaaaaccggtcgcagcattatcggctggcggtcactttgacccg
aaaaacaccggcaaacatcttggcccctggtctccggatggacacctgggcgacctccct
gcgctgttcgtgacgcatgacggaaaagcgaactacccggtcctggccccgagactgaac
tcattaaaagagattaaagggcgttctctcatgcttcatgctggcggtgataaccatcat
gaccatccggagcccctgggcggtggtggtgcgagaatggcctgcggcatcattcaataa

DBGET integrated database retrieval system