KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_1978Help
Entry
ECSP_1978         CDS       T00949                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase B, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00250  Alanine, aspartate and glutamate metabolism
etw00410  beta-Alanine metabolism
etw00430  Taurine and hypotaurine metabolism
etw00650  Butanoate metabolism
etw01100  Metabolic pathways
etw01110  Biosynthesis of secondary metabolites
etw01120  Microbial metabolism in diverse environments
etw02024  Quorum sensing
Module
etw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECSP_1978 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECSP_1978 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECSP_1978 (gadB)
   00430 Taurine and hypotaurine metabolism
    ECSP_1978 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECSP_1978 (gadB)
Enzymes [BR:etw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ECSP_1978 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACT71800
LinkDB All DBs
Structure
PDB: 

Position
complement(2005467..2006867)
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgcg
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgacgat
gtcgcatttcagattatcaatgacgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaacgtccacaagttgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatctgcagccatcgacctgcgttgc
gtaaatatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccaaacctggtgtgcggc
ccggtgcaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggatccgaaacgcatgattgaagcctgcgacgaa
aataccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
caaccgctgcacgatgcgctggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagtggtggcttcctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccacaaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctcggtggtcagattggtactttcgccatcaacttctcccgcccg
gcgggtcaggtaattgcacagtactatgaattcctgcgcctcggtcgtgaaggctatacc
aaagtacagaacgcctcttaccaggttgccgcttatctggcggatgaaatcgccaaactg
gggccgtatgagttcatctgtaccggtcgcccggacgaaggcattccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagtgatcacccgaaactgcagggtattgcccaacag
aacagctttaaacatacctga

DBGET integrated database retrieval system