KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_2722
Entry
ECSP_2722         CDS       T00949                                 

Gene name
stx2cB
Definition
(GenBank) Shiga-like toxin II subunit B precursor
  KO
K11007  shiga toxin subunit B
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw02024  Quorum sensing
etw05130  Pathogenic Escherichia coli infection
Module
etw_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:etw00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECSP_2722 (stx2cB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECSP_2722 (stx2cB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:etw02042]
    ECSP_2722 (stx2cB)
Bacterial toxins [BR:etw02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    ECSP_2722 (stx2cB)
SSDB
Motif
Pfam: SLT_beta DUF2541 Peptidase_C28
Other DBs
NCBI-ProteinID: ACT72519
LinkDB
Position
complement(2695183..2695452)
AA seq 89 aa
MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNENDTFTVKVAGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagtttctgttaatgcaatggcggcg
gattgcgctaaaggtaaaattgagttttccaagtataatgagaatgatacattcacagta
aaagtggccggaaaagagtactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system