KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_3215Help
Entry
ECSP_3215         CDS       T00949                                 

Definition
(GenBank) fused enoyl-CoA hydratase and epimerase and isomerase, 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00071  Fatty acid degradation
etw00280  Valine, leucine and isoleucine degradation
etw00281  Geraniol degradation
etw00310  Lysine degradation
etw00362  Benzoate degradation
etw00380  Tryptophan metabolism
etw00410  beta-Alanine metabolism
etw00640  Propanoate metabolism
etw00650  Butanoate metabolism
etw00903  Limonene and pinene degradation
etw00930  Caprolactam degradation
etw01100  Metabolic pathways
etw01110  Biosynthesis of secondary metabolites
etw01120  Microbial metabolism in diverse environments
etw01130  Biosynthesis of antibiotics
etw01200  Carbon metabolism
etw01212  Fatty acid metabolism
Module
etw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECSP_3215
   00650 Butanoate metabolism
    ECSP_3215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECSP_3215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECSP_3215
   00310 Lysine degradation
    ECSP_3215
   00380 Tryptophan metabolism
    ECSP_3215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECSP_3215
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECSP_3215
   00281 Geraniol degradation
    ECSP_3215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECSP_3215
   00930 Caprolactam degradation
    ECSP_3215
Enzymes [BR:etw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECSP_3215
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECSP_3215
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECSP_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACT72994
LinkDB All DBs
Position
complement(3180159..3182303)
Genome map
AA seq 714 aa AA seqDB search
MEMTSAFTLNVRLDNIAIITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSA
KPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKKDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEHKT
QGNYPATERILEVVETGLAQGTSSGYDAEARAFGELAMTPQSQALRSIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVAHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgacatcagcgtttactcttaatgttcgtctggacaacattgctatcatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaagcaactccgtgaaaacaaagagttgcgaggcgtggtgtttgtctccgct
aaaccggacaacttcattgctggcgcagacatcaacatgatcggcaattgcaaaacggcg
caagaagcggaagctctggcgcggcagggccaacagttgatggcggagattcatgctttg
cccattccggttatcgcggctattcatggcgcttgcctgggtggtgggctggagttggcg
ctggcgtgccacggtcgcgtttgtactgacgatcctaaaacggtgctcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgtctgataggc
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgatgttgttccgcactccattctgctggaagccgctgttgag
ctggcaaagaaggatcgcccatcttcccgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagaacacaaaact
caaggcaattatccggcgacagaacgcatcctggaggttgttgaaacgggattagcgcag
ggcaccagcagtggctatgacgctgaagcacgggcgtttggcgaactggcgatgacgcca
caatcgcaagctttgcgtagtatcttttttgccagtacggaagtgaagaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattttaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggattccggtcagaattaaagatatc
aacccgcagggcataaatcatgcgctgaagtacagttgggatcagctggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattgaaacaacagatggtggcggaagttgagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattggtgatatcgccgctcacgccacgcgacctgag
caagttatcggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcgggtacatcagcacaaaccatcgccactacggtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcatcttagcg
ccttacattaatgaagctatccgcatgctgaccgaaggtgaacgggtagcgcacattgat
gccgcgctagtgaaatttggttttccggtaggtccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggt
cgaggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcctgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagctgtacgttgtgttgatgagcaggttatccgt
agcgtgcgtgacggggatattggtgcggtatttggcattggttttccgccatttctcggt
ggaccgtttcgctatatcgattctctcggcgcgggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcacgttttaccccttgcgagcgtttagtcgagatgggtgcg
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system