KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_3607Help
Entry
ECSP_3607         CDS       T00949                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw00250  Alanine, aspartate and glutamate metabolism
etw00280  Valine, leucine and isoleucine degradation
etw00410  beta-Alanine metabolism
etw00640  Propanoate metabolism
etw00650  Butanoate metabolism
etw01100  Metabolic pathways
etw01120  Microbial metabolism in diverse environments
Module
etw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:etw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECSP_3607 (gabT)
   00650 Butanoate metabolism
    ECSP_3607 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECSP_3607 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECSP_3607 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECSP_3607 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etw01007]
    ECSP_3607 (gabT)
Enzymes [BR:etw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECSP_3607 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECSP_3607 (gabT)
Amino acid related enzymes [BR:etw01007]
 Aminotransferase (transaminase)
  Class III
   ECSP_3607 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACT73367
LinkDB All DBs
Structure
PDB: 

Position
3573883..3575163
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcaattcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgctgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggc
ctgatgccagggcacgtttatcgcgcgctttatccttgcccactgcacggcatcagtgaa
gatgatgctatcgccagtatccaccgaatttttaaaaatgatgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgcctgcg
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggcttcccactggcgggcgtcacc
gggcgcgccgaagtgatggatgccgtcgctccaggcgggctgggtggcacctatgccggt
aatccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcagaaagccaacgatctggggcagaagttgaaagatggattgttggcgatcgccgaa
aaacaccctgagatcggcgacgtacgcgggctgggggcgatgatcgccatcgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcaaagcagtag

DBGET integrated database retrieval system