KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_4665Help
Entry
ECSP_4665         CDS       T00949                                 

Gene name
espF
Definition
(GenBank) LEE-encoded type III secreted effector
  KO
K12786  LEE-encoded effector EspF
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Pathway
etw05130  Pathogenic Escherichia coli infection
Module
etw_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:etw00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECSP_4665 (espF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-ProteinID: ACT74386
LinkDB All DBs
Position
complement(4648402..4649148)
Genome map
AA seq 248 aa AA seqDB search
MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNART
IFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKP
ARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQA
SGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTGPSGLPPLAQALKDHLA
AYEQSKKG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattagtaacgctgcttctacactagggcggcagcttgtaggtatcgca
agtcgagtgagctctgcggggggaactggattttctgtagcccctcaggccgtgcgtctt
actccggtgaaagttcattcccctttttctccaggctcgtcgaatgttaatgcgagaacg
atttttaatgtgagcagccaggtgacttcatttactccctctcgtccggcaccgccgcca
ccgacaagtggacaggcatccggggcatcccgacctttaccgcccattgcacaggcatta
aaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagccc
gcccgtcaggcaccgccgccaccgacaagtggacaggcatccggggcatcccgaccttta
ccgcccattgcacaggcattaaaagagcacttggctgcctatgaaaaatcgaaaggtcct
gaggctttaggttttaagcccgcccgtcaggcaccgccgccaccgacaagtggacaggca
tccggggcatcccgacctttaccgcccattgcacaggcattaaaagagcacttggctgcc
tatgaaaaatcgaaaggtcctgaggctttaggttttaagcccgcccgtcaggcaccaccg
ccaccgacagggcctagtggactaccgccccttgcacaggcattaaaagatcatttagct
gcctatgagcaatcgaagaaagggtaa

DBGET integrated database retrieval system