KEGG   Escherichia coli O157 H7 TW14359 (EHEC): ECSP_5109Help
Entry
ECSP_5109         CDS       T00949                                 

Gene name
xylE
Definition
(GenBank) D-xylose transporter
  KO
K08138  MFS transporter, SP family, xylose:H+ symportor
Organism
etw  Escherichia coli O157:H7 TW14359 (EHEC)
Brite
KEGG Orthology (KO) [BR:etw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etw02000]
    ECSP_5109 (xylE)
Transporters [BR:etw02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    ECSP_5109 (xylE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-ProteinID: ACT74794
LinkDB All DBs
Structure
PDB: 

Position
complement(5114467..5115942)
Genome map
AA seq 491 aa AA seqDB search
MNTQYNSSYIFSITLVATLGGLLFGYDTAVISGTVESLNTVFVAPQNLSESAANSLLGFC
VASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPV
YLAGYVPEFVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYC
VNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGIL
RKIMGNTLATQAVQEIKHSLDHGRKTGGRLLMFGVGVIVIGVMLSIFQQFVGINVVLYYA
PEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLG
TAFYTQAPGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANY
FVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWEP
ETKKTQQTATL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccagtataattccagttatatattttcgattaccttagtcgctacattaggt
ggtttattatttggctacgacaccgccgttatttccggtactgttgagtcactcaatacc
gtctttgttgctccacaaaacttaagtgaatccgctgccaactccctgttagggttttgc
gtggccagcgctctgattggttgcatcatcggcggtgccctcggtggttattgcagtaac
cgcttcggtcgtcgtgattcacttaagattgctgctgtcctgttttttatttctggtgta
ggttctgcctggccagaacttggttttacctctataaacccggacaacacagtgcctgtt
tatctggcaggttatgtcccggaatttgttatttatcgtattattggcggtattggcgtt
ggtttagcctcaatgctttcaccaatgtatattgcggaacttgctcctgctcatattcgc
gggaaactggtttcatttaaccagtttgcgattattttcgggcagcttttagtttactgc
gtaaactattttattgcgcgttccggtgatgccagctggctgaatactgacggctggcgt
tatatgtttgcctcggaatgtatccctgcactgctgttcttaatgctgctgtataccgtg
ccagaaagtcctcgctggctgatgtcacgcggcaagcaagaacaggcggaaggtatcctg
cgcaaaattatgggcaacacgcttgcaactcaggcagtacaggaaattaaacactccctg
gatcatggccgcaaaaccggtggtcgtctgctgatgtttggcgtgggcgtgattgtcatc
ggcgttatgctctccatcttccagcaatttgtcggcatcaatgtggtgctgtactacgcg
ccggaagtgttcaaaacgctgggggccagcacggatatcgcgctgttgcagaccattatt
gtcggagttatcaacctcaccttcaccgttctggcaattatgacggtggataaatttggt
cgtaagccactgcaaattatcggcgcactcggaatggcaatcggtatgtttagcctcggt
accgcgttttacactcaggcaccgggtattgtggcgctactgtcgatgctgttctatgtt
gccgcctttgccatgtcctggggtccggtatgctgggtactgctgtcggaaatcttcccg
aatgctattcgaggtaaagcgctggcaatcgcggtggcggcccagtggctggcgaactac
ttcgtctcctggaccttcccgatgatggacaaaaactcctggctggtggcccatttccac
aacggtttctcctactggatttacggttgtatgggcgttctggcagcactgtttatgtgg
aaatttgtcccggaaaccaaaggtaaaacccttgaggagctggaagccctctgggaaccg
gaaacgaagaaaacacaacaaactgctacgctgtaa

DBGET integrated database retrieval system