KEGG   Faecalitalea cylindroides: EC1_16740Help
Entry
EC1_16740         CDS       T02586                                 

Definition
(GenBank) Glycosidases
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
euc  Faecalitalea cylindroides
Pathway
euc00500  Starch and sucrose metabolism
euc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:euc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EC1_16740
Enzymes [BR:euc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EC1_16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CBK88977
UniProt: D4JFK5
LinkDB All DBs
Position
complement(1547644..1549095)
Genome map
AA seq 483 aa AA seqDB search
MTKRTMIQYFEWYLKSDPPLYQTLMKEASSLSKMGFTHVWLPPAYKGQAGINDVGYGVYD
MYDLGEFDQKGSIRTKYGTKDEYIQAIDVCHQNSLQVIADIVFNHRMGADEKETIKATAM
DWNDRNRAVGQEKIVDVWTKYTFPVRNGKYSKFQWTWKDFDGTDYDAKTNQNVLMTFENK
KWDPKVSKEEGNFDFIMGDDLDFQNPNVIEELYHWGKWYKEFTNIDGYRLDAIKSIDSNF
FKGWLDKQKSYHTNDVYAVGEYWSGDLNELNTYLNDSGHCMHLFDVPLHFNLFNASSSYD
TYDMSRILDHTLVSSQNEYACPFVDNHDTQPGQALYSWVQGWFKLHAYSLILLRNFDNPC
VFYGDLYGIEHDNIGPVTHLSELVWIRSRILEDEIEDRFDDFHCIGWKVDGKHPIVVVMT
NGLANGKEFVIKNKSNIEFIDLVTKKTIKLDENGRGKFDCFDGGCSIFIESEVYQKMKEE
LEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagaacgatgattcaatattttgagtggtatttgaaatctgatccgccactc
tatcaaacactcatgaaagaagcatccagtttgtctaagatgggattcacacatgtctgg
cttcctcctgcttataaaggacaggccggcatcaatgatgttggctatggagtttatgat
atgtatgatcttggtgaatttgatcaaaaaggaagcatacggacaaaatatggaacaaaa
gacgaatatatccaggcaattgatgtctgtcatcaaaattctttacaggtcatagcggat
attgtgttcaatcatcgtatgggggccgatgaaaaagaaacaatcaaggcaacggcgatg
gattggaatgatcgtaatcgtgcagttggtcaagaaaaaatcgtagatgtctggacaaaa
tatacatttccggttcgtaatggcaagtattctaagtttcaatggacatggaaagacttt
gatggtaccgattatgatgccaagaccaaccaaaatgtattgatgacttttgaaaataag
aagtgggacccaaaagtttccaaagaagaaggtaattttgactttatcatgggagatgat
ctggattttcaaaatccgaatgtgattgaagaattgtatcactgggggaaatggtataaa
gaatttaccaacattgacggctatcgtttggatgccattaagagcattgattccaacttt
tttaaaggatggctggataaacagaaaagctaccacacaaacgatgtgtatgccgtaggg
gaatattggagtggagaccttaatgaattaaatacatatttaaatgacagtggtcattgt
atgcatttgtttgatgttcctttacattttaacctttttaatgcatcaagttcatatgat
acctatgatatgtctagaatattggatcatacactagtcagctcacagaatgagtatgca
tgtccttttgtggataatcacgatacacagccaggacaggctttatattcatgggtacag
ggatggtttaagttacatgcttatagtttgatcttattaagaaactttgacaatccatgt
gtattctatggcgatctatatggtatcgaacatgataatattggtccggtaacgcattta
agtgagttggtttggattcgaagtcgtatcctggaagatgagatagaagatcgctttgat
gattttcattgcattggctggaaagtggatggaaagcatccaattgttgtagtgatgacc
aatggactagccaatggaaaagaatttgtcataaaaaataaatcgaatattgaatttatt
gatcttgtcactaaaaaaacgataaaacttgatgaaaatggtcgtggaaagtttgactgt
tttgatggagggtgtagtatatttattgaaagcgaagtgtatcagaaaatgaaggaggaa
cttgaattatga

DBGET integrated database retrieval system