KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1592Help
Entry
ECUMN_1592        CDS       T00831                                 

Gene name
fabI
Definition
(RefSeq) enoyl-ACP reductase, NADH-dependent
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00061  Fatty acid biosynthesis
eum00780  Biotin metabolism
eum01100  Metabolic pathways
eum01130  Biosynthesis of antibiotics
eum01212  Fatty acid metabolism
Module
eum_M00083  Fatty acid biosynthesis, elongation
eum_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECUMN_1592 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECUMN_1592 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ECUMN_1592 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eum01004]
    ECUMN_1592 (fabI)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ECUMN_1592 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ECUMN_1592 (fabI)
Lipid biosynthesis proteins [BR:eum01004]
 Fatty acid synthase
  Component type
   ECUMN_1592 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 7158585
NCBI-ProteinID: YP_002412335
UniProt: B7N4A5
LinkDB All DBs
Structure
PDB: 

Position
complement(1602080..1602868)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELAKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaaccggtgttgccagcaaactgtccatc
gcctacggtatcgctcaggcgatgcaccgcgaaggagctgaactggcattcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgccgctcaattgggttctgacatcgtt
ctgcagtgcgatgttgcagaagatgccagcatcgacaccatgttcgctgaactggcgaaa
gtttggccgaagtttgacggtttcgtacactctattggttttgcacctggcgatcagctg
gatggtgactatgttaatgccgttacccgtgaaggcttcaaaattgctcacgacatcagc
tcctacagcttcgttgcaatggcaaaagcttgccgctccatgctgaatccgggttctgcc
ctgctgaccctttcctaccttggcgctgagcgcgctatcccgaactacaacgttatgggt
ctggcaaaagcgtctctggaagcaaacgtgcgctatatggcgaacgcgatgggtccggaa
ggtgtgcgtgttaacgccatctctgcgggtccgatccgtactctggcggcttccggtatc
aaagacttccgcaaaatgctggctcattgcgaagccgttaccccgattcgccgtaccgtt
accattgaagatgtgggtaactctgcggcattcctgtgctccgatctctctgccggtatc
tccggtgaagtggtccacgttgacggcggtttcagcatcgctgcaatgaacgaactcgaa
ctgaaataa

DBGET integrated database retrieval system