KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_1946Help
Entry
ECUMN_1946        CDS       T00831                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Brite
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECUMN_1946 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 7158678
NCBI-ProteinID: YP_002412675
UniProt: B7NBA9
LinkDB All DBs
Structure
PDB: 

Position
1970171..1970752
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattacctgcactaccatatgctaaagatgctctggcaccgcacatttct
gcggaaaccatcgagtatcactacggcaagcatcatcagacttatgtcactaacctgaac
aacctgatcaaaggtaccgcgtttgaaggtaaatcactggaagagattattcgcagctct
gaaggtggtgtattcaacaacgcagctcaggtctggaaccatactttctactggaactgc
ctggcaccgaacgcgggtggcgaaccgactggaaaagtcgctgaagctatcgccgcatct
tttggcagctttgccgatttcaaagctcagtttactgatgcagcgatcaaaaactttggt
tctggctggacctggctggtgaaaaacagcgatggcaaactggctatcgtttcaacctct
aacgcgggtactccactgaccaccgatgcaactccgctgctgaccgttgatgtctgggaa
cacgcttattacatcgactatcgcaatgcacgtcctggctatctggagcacttctgggcg
ctggtgaactgggaattcgtagcgaaaaatctcgctgcataa

DBGET integrated database retrieval system