KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2219Help
Entry
ECUMN_2219        CDS       T00831                                 

Gene name
amyA
Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00500  Starch and sucrose metabolism
eum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECUMN_2219 (amyA)
Enzymes [BR:eum01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECUMN_2219 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-GeneID: 7156413
NCBI-ProteinID: YP_002412941
UniProt: B7NBS2
LinkDB All DBs
Position
2239758..2241245
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggcgagtttgatcagaaaggcagcatccctactaaatatggcgataaa
gcacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcaacgtgta
aatgctgatgaccgtacgcaaattgatgaagaaatcattgagtgcgaaggctggacgcgt
tacaccttccccgcccgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaatcctgatgaagatggcatatttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggtgagaatatcgatttccgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcagtgcgacggttttcgtcttgatgcggtcaaacatatt
ccggcgtggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggcagagtactggtcgcatgaagtcgataaactgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgttcgatgcaccgctgcagatgaaattccatgaagcatcg
cgcatggggcgcgactacgacatgacgcagattttcacgggtacattagtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcccccgtcgaaccgtggtttaaaccgctggcgtatgctctaattttgttgcgggaaaat
ggcgttccttcggtgttctatcctgacctctatggcgcgcattacgaagatgttggcggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcactgacgaatatcccggttgcgtggtggtcatgtcgaacggg
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtgaccgacgaaaacggcgaagcaaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system