KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2581Help
Entry
ECUMN_2581        CDS       T00831                                 

Gene name
glpA
Definition
(RefSeq) sn-glycerol-3-phosphate dehydrogenase (anaerobic), large subunit, FAD/NAD(P)-binding
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00564  Glycerophospholipid metabolism
eum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECUMN_2581 (glpA)
Enzymes [BR:eum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECUMN_2581 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Thi4 Pyr_redox_2 3HCDH_N HI0933_like NAD_binding_8 Lycopene_cycl Pyr_redox_3 GIDA Pyr_redox
Motif
Other DBs
NCBI-GeneID: 7156571
NCBI-ProteinID: YP_002413292
UniProt: B7N5K5
LinkDB All DBs
Position
2656608..2658236
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDSESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADTPLPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccgggattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggtagaacgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctgcacagcggtgcgcgctat
gcggtaaccgattcggaatcggcccgcgaatgtattagtgaaaaccagatcctgaaacgc
attgcgcgtcactgcgttgaaccgaccaacggcctgtttatcaccctgccggaagatgat
ctctccttccaggccacttttatccgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaacatgctggat
gccaaagaacacggtgccgttatccttaccgctcatgaggtcacgggactgattcgtgaa
ggcgcgacggtgtgcggcgttcgtgtacgtaaccatctcaccggcgaaactcaggccctt
catgcgcctgtcgtggttaatgccgctgggatctgggggcaacacattgccgaatatgcc
gatctccgcattcgcatgttcccggcgaaaggatcgctgctgatcatggaccaccgcatt
aatcagcatgtgatcaaccgctgccgcaaaccgtccgacgccgatattctggtgcctggc
gataccatttcgctgattggcaccacctctttacgtattgattacaacgagattgacgat
aatcgagtgacggcagaagaagttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgggcctactctggcgtgcgtccactggttgccagc
gatgacgacccgagcggacgtaacgtcagccgtggcatcgtgctgctcgatcatgctgaa
cgcgatggtctggacggatttatcaccatcaccggtggcaaactgatgacctatcggctg
atggcggaatgggctaccgacgcggtatgtcgcaagctgggcaatacgcgcccctgtacc
actgccgacacgccgttgcctggctcacaggaaccggcagaagtcacgctgcgcaaagtg
atctccctgcccgctccgctgcgcggttccgcagtttaccggcacggcgatcgcacacca
gcctggctgagcgaaggccgcctgcaccgcagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcagtagaaaatttaaatgttaacagcctgctggatttacgc
cgtcgtacccgtgtagggatgggtacctgccagggcgaactctgcgcctgccgggctgcc
ggactgctgcaacgttttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatcgcctggggagacgcactgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system