KEGG   Escherichia coli O17 K52 H18 UMN026 (ExPEC): ECUMN_2986Help
Entry
ECUMN_2986        CDS       T00831                                 

Gene name
gabT
Definition
(RefSeq) PLP-dependent 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
eum  Escherichia coli O17:K52:H18 UMN026 (ExPEC)
Pathway
eum00250  Alanine, aspartate and glutamate metabolism
eum00280  Valine, leucine and isoleucine degradation
eum00310  Lysine degradation
eum00410  beta-Alanine metabolism
eum00640  Propanoate metabolism
eum00650  Butanoate metabolism
eum01100  Metabolic pathways
eum01120  Microbial metabolism in diverse environments
Module
eum_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECUMN_2986 (gabT)
   00650 Butanoate metabolism
    ECUMN_2986 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECUMN_2986 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECUMN_2986 (gabT)
   00310 Lysine degradation
    ECUMN_2986 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECUMN_2986 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eum01007]
    ECUMN_2986 (gabT)
Enzymes [BR:eum01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECUMN_2986 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECUMN_2986 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ECUMN_2986 (gabT)
Amino acid related enzymes [BR:eum01007]
 Aminotransferase (transaminase)
  Class III
   ECUMN_2986 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 7156483
NCBI-ProteinID: YP_002413679
UniProt: B7N6P6
LinkDB All DBs
Structure
PDB: 

Position
3096089..3097369
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHTEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagaattaatgcagcgccgcagtcaggcagttcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcagtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaagctgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgaaataatgaatcagaaggtgccgggcgat
tttgccaaaaaaacgctgctggtaacgaccggttctgaagcggtggagaacgcggtgaaa
atcgcccgcgccgccaccaaacgcagcgggaccatcgcctttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccttactctgcgggcatgggc
ctgatgccagggcatgtttatcgcgcactttatccgtgtccactgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggtgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgttgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatcttaccacctttgcgaaatcgatcgcaggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgcgggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaaactgaaagacggattgctggcgatagccgaa
aaacatactgagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccagacgcaaaactcaccgccgagatcgtggcgcgtgct
cgcgataagggcttgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgcagaggcgaagcagtag

DBGET integrated database retrieval system