KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_3252Help
Entry
UMNK88_3252       CDS       T02001                                 

Definition
(GenBank) P-protein
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eun01100  Metabolic pathways
eun01110  Biosynthesis of secondary metabolites
eun01130  Biosynthesis of antibiotics
eun01230  Biosynthesis of amino acids
Module
eun_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
eun_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMNK88_3252
Enzymes [BR:eun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     UMNK88_3252
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     UMNK88_3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 WWE
Motif
Other DBs
NCBI-ProteinID: AEE57802
UniProt: A0A0E0U2I4
LinkDB All DBs
Structure
PDB: 

Position
3149731..3150891
Genome map
AA seq 386 aa AA seqDB search
MTSENPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLI
TLGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNKINPHSARIAFLGPKGSYSHLAA
RQYAARHFEQFIESGCAKFADIFNQVETGQADYAVVPIENTSSGAINDVYDLLQHTSLSI
VGEMTLTIDHCLLVSGTTDLSTINTVYSHPQPFQQCSKFLNRYPHWKIEYTESTSAAMEK
VAQAKSPHVAALGSEAGGTLYGLQVLERIEANQRQNFTRFVVLARKAINVSDQVPAKTTL
LMATGQQAGALVEALLVLRNHNLIMTRLESRPIHGNPWEEMFYLDIQANLESAEMQKALK
ELGEITRSMKVLGCYPSENVVPVDPT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggaaaacccgttactggcgctgcgagagaaaatcagcgcgctggatgaaaaa
ttattagcgttactggcagaacggcgcgaactggccgtcgaggtgggaaaagccaaactg
ctctcgcatcgcccggtacgtgatattgatcgtgaacgcgatttgctggaaagattaatt
acgctcggtaaagcgcaccatctggacgcccattacattactcgcctgttccagctcatc
attgaagattccgtattaactcagcaggctttgctccaacaacatctcaataaaattaat
ccgcactcagcacgcatcgcttttctcggccccaaaggttcttattcccatcttgcggcg
cgccagtatgctgcccgtcactttgagcaattcattgaaagtggctgcgccaaatttgcc
gatatttttaatcaggtggaaaccggccaggccgactatgccgtcgtaccgattgaaaat
accagctccggtgccataaacgacgtttacgatctgctgcaacataccagcttgtcgatt
gttggcgagatgacgttaactatcgaccattgtttgttggtctccggcactactgattta
tccaccatcaatacggtctacagccatccgcagccattccagcaatgcagcaaattcctt
aatcgttatccgcactggaagattgaatataccgaaagtacgtctgcggcaatggaaaag
gttgcacaggcaaaatcaccgcatgttgctgcgttgggaagcgaagctggcggcactttg
tacggtttgcaggtactggagcgtattgaagcaaatcagcgacaaaacttcacccgattt
gtggtgttggcgcgtaaagccattaacgtgtctgatcaggttccggcgaaaaccacgttg
ttaatggcgaccgggcaacaagccggtgcgctggttgaagcgttgctggtactgcgcaac
cacaatctgattatgacccgtctggaatcacgcccgattcacggtaatccatgggaagag
atgttctatctggatattcaggccaatcttgaatcagcggaaatgcaaaaagcattgaaa
gagttaggggaaatcacccgttcaatgaaggtattgggctgttacccaagtgagaacgta
gtgcctgttgatccaacctga

DBGET integrated database retrieval system