KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_432Help
Entry
UMNK88_432        CDS       T02001                                 

Definition
(GenBank) alkaline phosphatase PhoA
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00730  Thiamine metabolism
eun00790  Folate biosynthesis
eun01100  Metabolic pathways
eun02020  Two-component system
Module
eun_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    UMNK88_432
   00790 Folate biosynthesis
    UMNK88_432
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UMNK88_432
Enzymes [BR:eun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UMNK88_432
Exosome [BR:eun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UMNK88_432
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eun00537]
 Enzymes
  UMNK88_432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AEE55079
UniProt: A0A0E0TVD3
LinkDB All DBs
Structure
PDB: 

Position
437849..439264
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKAAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGRGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNAVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaagctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgcgctagaaaaaggcgggagaggatcgattaccgaacagctgcttaacgct
cgtgccgatgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaatgcggtgacggaagcgaaccagcaaaaacccctgctaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggcaat
atcgacaagcccgcagttacctgtacgcctaatccgcaacgtaatgacagcgtaccgacc
ctggcgcagatgactgataaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcatcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgacgaagccgtacaacgggcgctggaattcgctaaaaag
gatggcaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggacaccaaagcgccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggtagtcagctgcgt
attgcggcgtatggcccacatgccgccaatgtcgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system