KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_526Help
Entry
UMNK88_526        CDS       T02001                                 

Definition
(GenBank) heat shock protein HtpG
  KO
K04079  molecular chaperone HtpG
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Brite
KEGG Orthology (KO) [BR:eun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eun01009]
    UMNK88_526
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eun03110]
    UMNK88_526
   04131 Membrane trafficking [BR:eun04131]
    UMNK88_526
   03051 Proteasome [BR:eun03051]
    UMNK88_526
   03029 Mitochondrial biogenesis [BR:eun03029]
    UMNK88_526
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eun04147]
    UMNK88_526
Protein phosphatases and associated proteins [BR:eun01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     UMNK88_526
Chaperones and folding catalysts [BR:eun03110]
 Heat shock proteins
  HSP90
   UMNK88_526
Membrane trafficking [BR:eun04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    UMNK88_526
Proteasome [BR:eun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    UMNK88_526
Mitochondrial biogenesis [BR:eun03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    UMNK88_526
Exosome [BR:eun04147]
 Exosomal proteins
  Proteins found in most exosomes
   UMNK88_526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c Apolipoprotein HP0268 PE
Motif
Other DBs
NCBI-ProteinID: AEE55173
UniProt: A0A0E0TUD7
LinkDB All DBs
Structure
PDB: 

Position
531121..532995
Genome map
AA seq 624 aa AA seqDB search
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGD
GELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLI
GQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHL
REGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSE
ITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLY
VQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQML
EKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYV
SRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPF
QSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKALLGERVKDVRLTHRLTDTPAIVS
TDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVLVKRAADTEDEAKFSEWVELLLDQA
LLAERGTLEDPNLFIRRMNQLLVS
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacaagaaactcgtggttttcagtcagaagtgaaacagcttctgcacctgatg
atccattctctctattccaataaagaaatcttcctgcgtgagcttatctctaacgcctcc
gatgcggcggacaagctgcgtttccgtgcgctctctaacccggacctgtacgaaggtgat
ggcgaactacgcgttcgtgtctctttcgataaagacaagcgtacgctgaccatctccgat
aacggcgtggggatgacccgcgacgaagtgattgaccatctggggactatcgctaaatcc
ggtaccaaatcattcctcgaatccctgggttctgaccaggcgaaagacagccagctgatc
ggtcagtttggtgttggtttctactctgcgtttatcgtggccgacaaagtgaccgtgcgt
actcgcgcggcaggcgaaaaaccagaaaatggcgtcttctgggaatcggctggcgaaggt
gaatacaccgttgccgacatcaccaaagaagatcgtggtactgaaatcaccctgcatctg
cgtgaaggcgaagacgagttcctcgatgactggcgcgtgcgttccatcatcagcaaatac
tccgaccatatcgcgctgccggtagagatcgaaaaacgcgaagagaaagacggcgaaacc
gttatctcctgggagaaaatcaacaaagcgcaggcgctgtggactcgtaacaagtcggaa
atcaccgatgaagagtacaaagagttctacaaacacatcgcccacgactttaatgatccg
ctgacctggagccacaaccgtgttgaaggtaagcaggagtacaccagcctgctgtacatc
ccgtcccaggctccgtgggatatgtggaaccgcgatcataaacacggcctgaaactgtat
gttcagcgtgtgttcatcatggacgacgcagaacagttcatgccgaactatctgcgcttc
gtgcgtggtctgattgactccagcgatctgccgctgaacgtttcccgtgaaatcctccag
gacagcacggtaacgcgtaacctgcgcaatgcgctgaccaagcgtgtgctgcaaatgctg
gaaaaactggcgaaagacgacgcggaaaaataccagaccttctggcaacagtttggcctg
gtactgaaagaaggtccggcggaagatttcgctaaccaggaagcgatcgccaaactgctg
cgttttgcttctacccataccgattcttctgcgcagaccgtatctctggaagactacgtt
tcccgcatgaaagaagggcaggagaaaatctactacatcaccgcagacagctatgcggca
gcgaagagcagcccgcacctggaactgctgcgtaagaaaggcatcgaagttctgctgctt
tccgaccgcatcgatgagtggatgatgaactatctgactgagttcgacggtaaaccgttc
cagtcggtgtctaaagttgacgagtcgcttgaaaaactggctgacgaagttgatgagagc
gcgaaagaagcggagaaagcactgactccgttcatcgaccgtgtgaaagccctgctcggc
gagcgcgtgaaagatgtccgtctgactcaccgtctgaccgatacgccagcgatcgtttcg
accgacgcggacgaaatgagcactcagatggcgaaactgttcgctgcggcgggccagaaa
gtgccagaagtgaaatacatcttcgaactgaacccggatcacgtactggtgaaacgtgcg
gcagatactgaagatgaagcgaagttcagcgagtgggtagaactgctgctggatcaggcg
ctgctggcagaacgcggcacgctggaagatccgaacctgtttattcgtcgtatgaaccag
ctgctggtttcctga

DBGET integrated database retrieval system