KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_538Help
Entry
UMNK88_538        CDS       T02001                                 

Definition
(GenBank) glutaminase YbaS
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00220  Arginine biosynthesis
eun00250  Alanine, aspartate and glutamate metabolism
eun00471  D-Glutamine and D-glutamate metabolism
eun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UMNK88_538
   00220 Arginine biosynthesis
    UMNK88_538
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    UMNK88_538
Enzymes [BR:eun01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     UMNK88_538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEE55185
UniProt: A0A0E0TUD6
LinkDB All DBs
Structure
PDB: 

Position
547642..548574
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtaccaggtcaactg
gcggcagtggctatcgtgacctgcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcactggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggcgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccatagcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtatacccgtcagtgctccacgctcctc
aatactattgaactggcaacgcttggcgcgacgctggcggcaggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgtgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggagtgatgggaattgccgcgttctca
ccaccgctggacgaagatggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system