KEGG   Eutrema salsugineum: EUTSA_v10000117mgHelp
Entry
EUTSA_v10000117mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eus  Eutrema salsugineum
Pathway
eus00010  Glycolysis / Gluconeogenesis
eus00030  Pentose phosphate pathway
eus00051  Fructose and mannose metabolism
eus00052  Galactose metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01200  Carbon metabolism
eus01230  Biosynthesis of amino acids
eus03018  RNA degradation
Module
eus_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUTSA_v10000117mg
   00030 Pentose phosphate pathway
    EUTSA_v10000117mg
   00051 Fructose and mannose metabolism
    EUTSA_v10000117mg
   00052 Galactose metabolism
    EUTSA_v10000117mg
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EUTSA_v10000117mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eus01009]
    EUTSA_v10000117mg
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eus03019]
    EUTSA_v10000117mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EUTSA_v10000117mg
Protein phosphatases and associated proteins [BR:eus01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUTSA_v10000117mg
Messenger RNA biogenesis [BR:eus03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EUTSA_v10000117mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 18021719
NCBI-ProteinID: XP_006404705
UniProt: V4M1S4
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MEALSQAISSGVSVPYKKSSAPIQSHGPISSLILRKARSPANPSPVSSRSSLIRASSIQH
SKSSASIDLSDPNWKSKYERDFEQRFSIPHITDVFPDAEAIRSTFCLKMRSPTEDFVGGY
PSDEEWHGYINNNDRVLLKVISYSSPTSAGAECIDPDCSWVEQWIHRAGPREKIYFRPEQ
VKAAIITCGGLCPGLNDVIRHIVITLEIYGVKNIVGIPFGYRGFSDKDLTEMPLSRKVVQ
NIHLSGGSLLGVSRGGPSVSEIVDSMEERGINMLFVLGGNGTHAGANAIHNECRKRKLKV
AVVGVPKTIDNDILHMDKTFGFDTAVEEAQRAINSAYIEAHSAYHGMGIVKLMGRNSGFI
AMQASLASGQVDICLIPEVPFNLHGPNGVLKHLKYLIETKGSAVICVAEGAGQNLLEKTN
AKDASGNTILGDFGVHIQQETKKYFKEVSIPIDVKYIDPTYMIRAVRANASDGILCTVLG
QNAVHGAFAGYSGITVGIINTHYAYLPITEVIEYPKSVDPNSRMWHRCLTSTGQPDFI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggaagctctttctcaggcgatcagctccggcgtctccgttccttacaagaagagctct
gctccaatccagtcacatggacccatcagctcgttaatcctccggaaagcgagatctccg
gcgaatccctcaccggtttcttctcgtagctcgttgatccgagcttcatcgattcagcat
agcaaaagctcggcatcgatcgatctcagcgatccgaattggaaatcaaagtacgagaga
gacttcgagcaaagattcagcatccctcacatcactgatgtctttccagatgcagaagca
attcgttctacgttttgtctcaagatgaggtctccgacggaagattttgttggtggttac
ccttctgatgaagaatggcatggatacattaataacaacgatagagttcttctcaaggtt
attagttactcttcaccaacttctgctggagcagagtgcattgatcctgactgttcttgg
gttgagcaatggattcaccgtgctgggccgagggagaagatatactttagaccggaacaa
gtgaaggctgcgattatcacttgtggtggtctttgtcctggtctcaatgatgtcatcaga
catattgtgatcactcttgagatatatggtgttaagaacattgttgggattccgtttggt
tatcgaggcttctctgataaagatcttaccgaaatgccgttatcaaggaaagttgttcaa
aatattcatctatctggaggaagtttgcttggagtttcacgtggaggtccgagtgtgagc
gaaattgttgacagtatggaggagagaggaatcaacatgcttttcgtattgggtggaaac
ggaactcatgctggcgcaaacgccatacacaatgagtgccgcaaaagaaagttgaaggta
gctgtagttggtgtgccaaaaaccattgacaatgatattttgcatatggataaaactttt
gggtttgatactgctgttgaagaagcacaacgagctataaactctgcctatattgaggca
catagtgcttaccatggcatgggtattgtaaaactgatgggtcgtaacagtggtttcatt
gcgatgcaagcctctctagcaagcggacaagtcgacatctgtttgattcctgaggttccc
tttaatcttcatgggcctaatggtgtactgaagcatttgaagtacctaatcgaaacaaaa
ggctctgctgtgatctgtgtagcagaaggagctggacagaatctactcgagaaaactaat
gccaaagatgcatctggaaacacaattcttggggattttggtgtgcacatccaacaagag
acaaaaaagtatttcaaagaagtaagtatcccaatagatgtgaaatatattgatccaaca
tacatgattcgagctgttcgtgcaaatgcctcagatggtatcctctgcaccgttcttgga
caaaacgctgttcatggtgcgtttgctggatacagtggaatcactgtaggcatcatcaac
actcactacgcgtatttgccaatcactgaagtaattgaatatccaaaatcagttgatccc
aatagtcgaatgtggcatcgttgcttgacatcaacaggtcaacctgatttcatatga

DBGET integrated database retrieval system