KEGG   Eutrema salsugineum: EUTSA_v10001516mgHelp
Entry
EUTSA_v10001516mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
eus  Eutrema salsugineum
Pathway
eus00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    EUTSA_v10001516mg
Enzymes [BR:eus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     EUTSA_v10001516mg
Chromosome and associated proteins [BR:eus03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     EUTSA_v10001516mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 18015850
NCBI-ProteinID: XP_006397594
UniProt: V4L9M3
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MPSAKKISDRNHIGQVFNKLLNQIGEAEEFELPDWLNKGKPTPYIFIRRNIYLTKKFKRR
VEDDGIFCSCSLSPGSSSSTVCGSNCHCGMLFSSCSSSCKCGSECNNKPFQQRHVKKMKL
TQTEKCGSGIVAEEEIKQGEFIIEYVGEVIDDKTCEERLWKMKHRGETNFYLCEINRDMV
IDATHKGNKSRYINHSCNPNTQMQKWIIDGETRIGIFATSDIKKGEHLTYDYQFVQFGAD
QDCHCGATGCRRKLGVKPSKPKLASDEALNLVECEVAQTLPKVHENGSIHEGKSWNKLSQ
VQICPRNCIGMVIRLSRPTSDRCFGLIRHFDEFSRKHSVMFEDGVTEFIDMLREDWEIVS
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgcgaagaagatttccgaccggaaccacataggacaagtgttcaacaagttg
ttgaatcagattggagaagcagaggagtttgagttgccggattggttaaacaaagggaaa
cctactccttacatcttcatcaggcgcaatatatacttgacgaagaaattcaaaaggagg
gttgaggatgatggaatattctgttcttgttccttgtcccctggttcttcttcttcaact
gtctgtgggagtaattgccattgtgggatgctattctcaagctgttcctcaagttgcaag
tgtgggagtgagtgtaacaataagccgttccagcaacggcatgtcaagaaaatgaagtta
actcagacagaaaagtgcggatcagggattgtagcagaagaagaaatcaaacaaggagag
tttatcattgaatatgttggagaagttatagatgataagacttgtgaagaaaggctttgg
aagatgaaacaccgtggcgagacgaatttctatttgtgcgagataaacagagatatggtg
attgacgctactcacaagggaaataaatcgagatatattaatcatagttgcaaccctaat
acgcagatgcagaaatggataattgacggcgagacaagaatcggtatttttgccacctcc
gacataaaaaagggagagcatttgacttatgactaccagtttgttcagtttggtgcagat
caagactgccattgtggggccacaggttgcagaaggaagcttggtgtcaaacctagcaaa
cctaagttagcctcggatgaagcactaaatctagtggaatgtgaagtggcccagactctg
cctaaggtacatgaaaatggaagtatacatgaaggaaaatcatggaataagcttagtcaa
gtgcaaatatgtcctcgtaattgcattggtatggtgatcaggttatctcgccccacgagt
gacaggtgtttcgggctcattagacattttgatgagttttcaagaaagcactcggtgatg
ttcgaggatggtgttaccgagtttatcgacatgttgagagaagattgggagattgtaagt
gtctaa

DBGET integrated database retrieval system