KEGG   Eutrema salsugineum: EUTSA_v10001968mgHelp
Entry
EUTSA_v10001968mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
eus  Eutrema salsugineum
Pathway
eus00010  Glycolysis / Gluconeogenesis
eus00051  Fructose and mannose metabolism
eus00052  Galactose metabolism
eus00500  Starch and sucrose metabolism
eus00520  Amino sugar and nucleotide sugar metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01200  Carbon metabolism
Module
eus_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eus_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUTSA_v10001968mg
   00051 Fructose and mannose metabolism
    EUTSA_v10001968mg
   00052 Galactose metabolism
    EUTSA_v10001968mg
   00500 Starch and sucrose metabolism
    EUTSA_v10001968mg
   00520 Amino sugar and nucleotide sugar metabolism
    EUTSA_v10001968mg
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EUTSA_v10001968mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eus04131]
    EUTSA_v10001968mg
Enzymes [BR:eus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     EUTSA_v10001968mg
Membrane trafficking [BR:eus04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    EUTSA_v10001968mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 18025781
NCBI-ProteinID: XP_006408903
UniProt: V4NUC5
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MGKVAVGATVVCAAAVCAAAVFIVRRRMQSSGKWARVIEILKVLEEDCATPIAKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPSGDEHGFFYALDLGGTNFRVMRVLLGGKQDR
VVKQEFEEVSIPPHLMTGGSDELFNFIAEALAKFVATEGEDFHLPAGRQRELGFTFSFPV
RQTSLSSGTLIKWTKGFSIEDTVGQDVVGELIKAMERVGLDMNVTALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
SLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEEAAFFGDSVPPKLRIPFIIRTPNM
SAMHSDTSPDLKVVGSKLKDILEVPTTSLKMRKVVISLCNIIASRGARLSAAGIYGILKK
LGRETPKDGETQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASESVEVIHSNDGSGV
GAALLAASHSQYLEDSETS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtggctgttggtgcgacggttgtgtgcgctgcggcggtttgtgcggcggcc
gtgtttattgtgcggcggcggatgcaaagctctggaaaatgggctcgagtgattgagatc
ttgaaggtgctcgaggaggattgcgcaacgccaatcgccaaacttagacaggtggctgat
gctatgaccgttgagatgcacgccggtctcgcatccgaaggtggaagcaagctcaagatg
cttattagctacgtcgataatcttccttctggggatgaacatggtttcttttatgcactg
gacctaggtggaacaaacttccgtgtcatgcgtgtgcttcttggtggtaaacaagaccgt
gttgtcaaacaagaattcgaagaagtctcaattcctcctcatttgatgaccggcggctca
gatgaattatttaattttatcgctgaagcgcttgcaaagttcgtcgctacagaaggcgag
gactttcatctcccagcgggtagacaaagagaattaggtttcactttctcttttccggtt
cggcagacgtctttgtcatctggcactctcatcaagtggaccaaaggattttccattgaa
gatacagttggacaagatgttgtcggagagcttattaaagctatggaaagagttgggctc
gacatgaatgttacagcccttgtaaatgatacagtgggaacacttgctggtggtagatac
tataacccggatgttgttgccgctgttattttaggcactggcacaaatgcagcttatgtc
gaacgtgcacatgcaattcccaaatggcacggcttacttcccaaatcaggagaaatggtg
atcaacatggagtggggtaacttcaggtcatcgcatcttccattgacagagtatgaccac
tcactagatttcgagagtctgaatccaggtgaacagattcttgagaagatcatttccggt
atgtatttgggagaaatcttgcgtagagttcttctgaaaatggctgaagaggctgctttc
tttggcgactctgtccctcctaagctgagaataccattcatcataaggacaccgaacatg
tctgctatgcacagcgatacttctccggatttgaaggttgtcggaagcaagttaaaggac
atattagaggtccctacgacttctctgaagatgagaaaagttgtgatcagtctctgtaac
atcatcgctagccgaggagctcgtctatctgctgctgggatctatgggatcctcaagaaa
ctaggaagagagacaccaaaagatggagaaactcagaaatctgtgatcgccatggacggt
ggactgttcgagcactacactcagttcagcgagtgtatggagagctcattgaaagagttg
ctcggagatgaagcatcagagagcgtcgaggtgattcattcgaatgacgggtctggtgtt
ggagccgcgttactcgctgcctcacactctcaataccttgaggactctgaaacaagttaa

DBGET integrated database retrieval system