KEGG   Eutrema salsugineum: EUTSA_v10003787mgHelp
Entry
EUTSA_v10003787mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eus01009]
    EUTSA_v10003787mg
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eus03019]
    EUTSA_v10003787mg
   04131 Membrane trafficking [BR:eus04131]
    EUTSA_v10003787mg
   03036 Chromosome and associated proteins [BR:eus03036]
    EUTSA_v10003787mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     EUTSA_v10003787mg
Protein phosphatases and associated proteins [BR:eus01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EUTSA_v10003787mg
Messenger RNA biogenesis [BR:eus03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     EUTSA_v10003787mg
Membrane trafficking [BR:eus04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    EUTSA_v10003787mg
Chromosome and associated proteins [BR:eus03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     EUTSA_v10003787mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18012381
NCBI-ProteinID: XP_006394541
UniProt: V4KPD7
LinkDB All DBs
Position
Unknown
AA seq 653 aa AA seqDB search
MAMAGDSSGNKCGDCDGDFVGNSKRKVGLLYDERMCKHDTPDGEDHPECPDRIRVIWEKL
QLTGLAQRCVVLGGSKAEDKHLQLVHTKEHVNLVKSLSTKQKDYRRNRIASHLNSIYLNG
GSSEAAYLSAGSVVEVAEKVAEGELDCGFAIVRPPGHHAEADEAMGFCLFNNVAVAASYL
LNERPDLGIKKILIVDWDVHHGNGTQKMFWKDPRVLFFSAHRHEFGGFYPAGDDGYYNMV
GEGPGEGFNINVPWEQGRCGDADYLAAWDHILIPVVKEFNPDIILLSAGFDAAIGDPLGG
CRVTPYGYSVLLKKLMEFAQGKIVMALEGGYNLDSIAKSSLACVQVLLEDKPIQDSSEAY
PFESTWRVIQAVRKRLCVYWTSLADELSWKLIDQKTPTPIILASSSDSETEDHTHEILDQ
MSKLNIENHQVDTVSPSWRTNLAKVDVWYASFGSNMWKPRFLCYIQGGQVEGMKRACVGS
MDKSPPKEIMWETFPHRLFFGRESTVTWGVGGVAFTNPLANLTDQTHMCLYRITLEQFND
VLFQENGLKVDSDSPLFDLAALQLVENKGSIPLEAASDGWYGNVVCLGKQCDIPILTMTC
TLSAVENFISGEIPLRPPSKAYANTLVRGLVEGGRFSEEEAVAYIDNAASKPL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccggcgattcttccggtaacaaatgcggagactgtgacggagatttcgtt
gggaacagcaagcgaaaggttggtcttttatacgacgagaggatgtgcaaacacgacaca
cctgacggcgaggatcatccagagtgtcctgatcgcatcagagttatctgggagaagctt
cagctcactggactcgctcaaagatgtgtggtgcttggtggtagcaaagcagaagataag
catctccaattggttcacacaaaagaacatgttaatttagttaagagtttaagcacaaaa
cagaaggattatcggagaaacaggattgcttcacatttgaattcaatatatctgaatgga
ggttcatctgaagctgcatatctttcagctggatctgttgtggaggtggcggagaaagtt
gcagaaggagagttagattgtggctttgctattgttagaccaccagggcaccatgctgag
gcagatgaagctatgggtttctgtttattcaacaatgtcgcagttgctgctagttattta
ctaaacgaaagaccggatctaggtattaagaaaattctgatagttgattgggatgtacat
cacggaaatggtacgcagaagatgttctggaaagatcctcgtgtactgtttttctctgct
cataggcatgagtttggaggcttctatccagcgggtgatgatggatattataacatggtt
ggggaaggcccaggtgaagggtttaacataaacgttccatgggagcaaggaagatgtgga
gatgcagattatcttgccgcatgggaccatatcttgattcctgtggtgaaggaattcaat
cccgatattattttgctttcagctggatttgatgcagctattggtgatccacttgggggt
tgtcgtgttacaccatatggctattcagttttgttgaagaagctgatggagtttgcacaa
ggaaagattgtgatggcgttggagggaggatacaatcttgactcaattgcaaagtcttca
ctggcatgtgtccaagttttgcttgaagacaaaccaattcaagattcttctgaagcatac
ccattcgagtctacatggcgtgttatacaagcggtacgcaagaggctatgtgtttattgg
acttcacttgcagatgaattatcatggaagctcattgaccagaaaactcctactccaatt
atccttgcctcaagctccgactctgaaaccgaagaccacactcatgaaatcctggatcaa
atgtcgaaactcaacattgaaaaccaccaagtagatactgtttctccatcttggagaact
aatctcgcaaaggttgacgtttggtatgcctcttttggatccaacatgtggaaaccgagg
ttcctttgctatattcaagggggtcaagtcgagggaatgaaaagagcatgtgttggttca
atggataaaagtccaccaaaagaaataatgtgggaaacatttccacacaggttattcttt
ggccgtgaatctacagttacttggggtgtaggaggagttgcttttaccaatccccttgct
aacctcactgatcaaactcacatgtgcttgtatagaatcacgcttgagcagttcaatgat
gttctgtttcaggaaaatggcttgaaagtagattctgattctccgctctttgatctagct
gctctgcagttagtagagaacaaaggatccattccacttgaagctgcttcggatggctgg
tatggaaacgttgtctgcttggggaaacaatgcgacatccctatacttacaatgacttgc
acactttctgctgttgagaatttcatatccggtgagatccctttaagacctccttcaaaa
gcttatgccaacactttggtaaggggacttgttgaaggaggaagattctctgaagaagaa
gctgtggcgtacatagacaatgctgcatctaaacctctctag

DBGET integrated database retrieval system