KEGG   Eutrema salsugineum: EUTSA_v10003821mgHelp
Entry
EUTSA_v10003821mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
eus  Eutrema salsugineum
Pathway
eus00020  Citrate cycle (TCA cycle)
eus00190  Oxidative phosphorylation
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EUTSA_v10003821mg
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EUTSA_v10003821mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EUTSA_v10003821mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18011543
NCBI-ProteinID: XP_006393871
UniProt: V4KMJ1
LinkDB All DBs
Position
Unknown
AA seq 626 aa AA seqDB search
MWRCVSRSLRAPYSRTSLSGSRISRLFSTGSTDDYKIVDHTYDAVVVGAGGAGLRAAIGL
SEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAIQ
YMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAL
LHTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFRSAQTILATGGY
GRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILR
NSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLKER
LPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAA
GEAACASVHGANRLGANSLLDIVVFGRACANRVAEINKPGEKQRPLEEDAGRKTIEWLNK
LRNSRGSLPTSSIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLIW
NSDLIETIELENLLINAAITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKV
RLDYRPVHMDTLDDEIETFPPKARVY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtagccttcgagctccttattcaaggacctcactctctgga
tctcggatttctagattattctccacgggttcgaccgatgactacaagatagtggatcac
acctatgacgcggtggtggttggagctggtggtgcaggacttagggcggcgattggatta
tcggagcatggctttaacaccgcttgcattaccaagcttttccccacacggtcacatact
gtcgctgctcagggtggcattaatgctgcactaggaaatatgtctgaagatgactggaga
tggcacatgtatgatactgtgaaaggaagtgactggctaggtgatcaagatgctatccag
tatatgtgcagagaggcacccaaggcagtgattgaacttgagaattatgggctgccgttt
tctcgtactgaagaggggaaaatttaccagcgtgcatttggtggtcagagtcttgacttt
ggaaaaggtggtcaggcctatcgttgtgcttgtgctgcggatcgtactgggcatgctctc
ttgcataccctctatggacaagctatgaagcataacacccagttctttgttgaatacttc
gctctggatttgctcatggctagtgatggcagttgccagggtgtaattgcactaaacatg
gaggatggaacattgcatcgtttccgctctgcacaaacaattttggccactggggggtat
ggaagagcgtacttctctgcaacttcagcacatacatgcacaggagatggcaatgccatg
gttgcacgggctggtcttccactccaggacttggagtttgttcaattccatcctactggt
atatatggggccggatgtctcatcactgaaggatctcggggtgaaggtggtatccttaga
aacagtgaaggtgagcgttttatggaacgatatgctcctacagccaaagatcttgcatca
agagatgttgtctccagatctatgactatggaaatcagggaaggtcgtggtgtaggaccg
cataaggatcatatctatctccatttgaatcatcttccaccagaagttctaaaagaaagg
cttcctggaatctctgagactgctgctatctttgctggtgttgatgttaccaaagagcca
attccagtcttgcccactgttcattataacatgggtggtatcccaacaaattaccacgga
gaggtagttaccatcaaaggtgatgatccagatgcagtggttcctgggcttatggctgct
ggggaggcagcttgtgcatctgttcatggtgccaacaggcttggtgcaaattctctcctc
gacattgttgtgtttggccgtgcttgtgcaaatagggttgcagagataaacaaaccagga
gagaaacagaggcctcttgaggaggatgcaggtaggaagactatcgaatggctgaacaag
ttaagaaactcaagagggtcgcttcctacttcaagtatcagattgaacatgcagaggatt
atgcagaacaatgcagctgtcttccgcacccaagaaactttggaagaaggttgtcagttg
atcgacaaggcctgggaaagtttcgaggatgtccaggttaaagataggagtttgatatgg
aactctgatttgatagagacaatagaactggagaatcttttgataaacgctgccataaca
atgcattcagcggaagcacgaaaggaaagcagaggagcacatgctcgggaagatttcacg
aaaagagaggatggagagtggatgaagcatacattgggatattgggaagatgagaaagtg
agattggattataggcctgtccacatggacactcttgacgatgagattgagactttccct
cccaaagctcgcgtctattga

DBGET integrated database retrieval system