KEGG   Eutrema salsugineum: EUTSA_v10004077mgHelp
Entry
EUTSA_v10004077mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eus  Eutrema salsugineum
Pathway
eus00010  Glycolysis / Gluconeogenesis
eus00020  Citrate cycle (TCA cycle)
eus00620  Pyruvate metabolism
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01200  Carbon metabolism
Module
eus_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUTSA_v10004077mg
   00020 Citrate cycle (TCA cycle)
    EUTSA_v10004077mg
   00620 Pyruvate metabolism
    EUTSA_v10004077mg
Enzymes [BR:eus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EUTSA_v10004077mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF721 Pyridox_oxase_2
Motif
Other DBs
NCBI-GeneID: 18013044
NCBI-ProteinID: XP_006395617
UniProt: V4KZK8
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MAVSSSSFLSTASLSNSKSTISFASSVSPTPIPSLRRVVFRSSIPASSHRRVMTVRSKIR
EIFMPALSSTMTEGKIVSWIKTEGEKLAKGESVVVVESDKADMDVETFYDGYLAAIVVGE
GETAPVGAAIGLLAETEAEIEEAKTKAASKSSSSSSSPPAAAEALVPSPPPATSSPAPAI
AQPAPVATVPDGPRKTVATPYAKKLAKQHKVDIGSIAGTGPFGRITASDVEAAAGIAPSK
STVAPPPSPPPAPTATAATAKPTTTNLPPLLPDSSIVPFTAMQSAVSKNMIESLSVPTFR
VGYPVNTDALDALYEKVKPKGVTMTALLAKAAGMALAQHPVVNASCKDGKSFSYNSNINI
AVAVAINGGLITPVLQDADKLDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMF
GVDRFDAILPPGQGAIMAVGASKPTVVADKDGFFSVKNKMLVNVTADHRIVYGADLAAFL
QTFAKIVENPDSLTL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcttcttcttcgtttctatcgacggcttctctctccaattccaaatccacc
atttcattcgcttcctccgtctcccctacgcctatcccttccctccgccgcgtcgttttc
cgctcctcgattccggcgtcttctcaccggagagtcatgacggtccgatccaaaatcagg
gaaattttcatgccggcgctctcttcaacaatgacggaagggaaaatcgtatcctggatc
aaaaccgaaggcgagaaactcgccaagggagagagtgttgtcgttgtggagtccgataag
gcggatatggatgtagaaaccttctacgacggttatctcgccgcaatcgtcgtcggagag
ggagagacagctccggtaggcgctgcaattggattgttggcggagactgaagctgagatc
gaagaagctaagaccaaagccgcatcgaaatcttcctcttcctcttcctctccacccgct
gctgcggaggcccttgttccatctcctcctcctgctacttcatctcccgcgccggcgatc
gctcagccggctccggtggcgacggtaccagatggtccgagaaaaaccgtcgcgacgccg
tatgctaagaagctcgcgaaacagcacaaggtagatatcggatccattgcaggaactgga
ccattcggtaggattacggcttctgacgtggaggcggcggcaggaattgctccttccaaa
tccaccgtggcaccgccgccttctcctcctccggcaccaacagctacggcggcgacggcg
aaacctaccaccactaacttgcctcctctattgcctgattccagcattgtccctttcaca
gcaatgcaatctgcagtttccaaaaacatgatcgagagtctctccgttcccacattccgt
gttggttatcctgtgaacactgatgctctcgatgcactctatgaaaaggtgaagccaaag
ggtgtaacaatgaccgccttattggccaaagctgcagggatggctcttgcgcagcatcct
gtggtgaacgcaagctgcaaagatgggaagagttttagttacaatagtaacattaacatt
gcggttgctgttgctatcaatggggggctcattacgcctgttctacaagatgcagataag
ttggatttatacttgttatcccaaaaatggaaagagctggtggggaaagctagaagcaag
caattgcaacctcatgaatacaactctggcactttcactttgtcgaatctcggtatgttt
ggagtggatagatttgatgcaattctcccgccaggacagggtgctataatggctgttgga
gcgtcaaagccaactgttgttgctgacaaggatggattcttcagtgtgaaaaacaaaatg
ctggtgaatgtgactgcagatcatcgaattgtctatggagctgacctggctgcttttctt
caaacctttgcaaagatcgttgagaatccagatagtttgaccttatag

DBGET integrated database retrieval system