KEGG   Eutrema salsugineum: EUTSA_v10007303mgHelp
Entry
EUTSA_v10007303mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
eus  Eutrema salsugineum
Pathway
eus00010  Glycolysis / Gluconeogenesis
eus00053  Ascorbate and aldarate metabolism
eus00071  Fatty acid degradation
eus00280  Valine, leucine and isoleucine degradation
eus00310  Lysine degradation
eus00330  Arginine and proline metabolism
eus00340  Histidine metabolism
eus00380  Tryptophan metabolism
eus00410  beta-Alanine metabolism
eus00561  Glycerolipid metabolism
eus00620  Pyruvate metabolism
eus00903  Limonene and pinene degradation
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUTSA_v10007303mg
   00053 Ascorbate and aldarate metabolism
    EUTSA_v10007303mg
   00620 Pyruvate metabolism
    EUTSA_v10007303mg
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EUTSA_v10007303mg
   00561 Glycerolipid metabolism
    EUTSA_v10007303mg
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EUTSA_v10007303mg
   00310 Lysine degradation
    EUTSA_v10007303mg
   00330 Arginine and proline metabolism
    EUTSA_v10007303mg
   00340 Histidine metabolism
    EUTSA_v10007303mg
   00380 Tryptophan metabolism
    EUTSA_v10007303mg
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EUTSA_v10007303mg
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EUTSA_v10007303mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     EUTSA_v10007303mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 18992580
NCBI-ProteinID: XP_006416054
UniProt: V4KWI9
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MASRRVSSLLSRSFFSSSSLFALSGKNPHLMNRGARRYSNLAAAAAALEDTITPPVKVEH
TQLLIGGKFVDAASGKTFPTLDPRTGEVIAQVAEGDVEDVNRAVLAARKAFDEGPWPRMT
AYERSKILFRFADLIEKHNDEIAALETWDNGKPYEQSAKIEVPMLARVFRYYAGWADKIH
GMTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTIVLKTAEQTPLS
ALLVAKLLHEAGLPEGVVNIVSGFGATAGAAIASHMDIDKVAFTGSTDVGKIILKLASES
NLKAVTLELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVE
KAKARAINRTVGDPFKSGIEQGPQVDKEQFKKILKYIKYGVDSGATLQAGGDQLGSKGYY
IQPTVFSDVKDDMLIAQDEIFGPVQTILKFKDLDEVIARANKSRYGLAAGVFTQNLDTAN
RLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTALKNPAW
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaagagtctcctcgctgctctctcgctccttcttttcctcgtcttctctt
ttcgctcttagtggtaaaaatccacacttgatgaacagaggagctcggagatacagcaac
ctcgccgccgctgctgcagctctcgaagacacgattactccacctgtgaaagtcgagcac
actcagctcttaatcggcggaaaattcgtcgatgcagcctcaggaaaaacattccccact
ttggatccaagaactggagaagtgatagctcaggtggcagaaggtgatgtagaagacgtg
aaccgtgcggttttagccgcacgcaaggcctttgatgagggaccatggcctagaatgaca
gcttatgagagatcaaagatactatttcgtttcgctgacttgatagagaaacacaacgac
gagattgcagctcttgagacttgggacaatgggaagccttatgagcaatctgccaaaatc
gaagtgcctatgcttgctagagtgttccggtactatgctggttgggcagacaagattcat
ggaatgacggttccaggagatggttcacaccatgttcagactcttcatgagcccatagga
gtcgctggacagatcatcccatggaacttccctcttctcatgctttcttggaaacttgga
cctgctttagcttgcggaaacaccattgttctcaagacggctgagcaaactcctttatct
gctcttcttgttgcaaaactacttcacgaggctggacttcctgaaggagttgtaaatata
gtttctggatttggtgctacagctggtgcagccattgctagtcacatggacattgataag
gttgccttcaccgggtctactgacgtgggaaagattattcttaagctggcttcagaaagc
aaccttaaggcagtgactcttgagcttggaggcaagtcaccattcattgtatgtgaagat
gctgatgtggatcaggcagttgagcttgctcatttcgctttgttctttaaccagggacaa
tgctgttgtgctggctcgcgtacattcgtacatgaacgagtgtatgatgagtttgtagag
aaagctaaagctcgtgcaatcaaccgtactgttggcgatcccttcaagtcaggcattgag
caaggtccccaggtagacaaagagcaattcaagaaaatcctaaagtacatcaaatatgga
gttgacagtggagccactttacaagctggaggtgaccagcttggttccaaaggttactac
attcaacccactgtcttctcagacgtgaaagacgacatgctcatagcacaagacgagatt
tttgggcctgttcaaaccatactaaagttcaaggatttggatgaggtgattgcgagggca
aacaagtcgaggtacggtttagctgcaggagtgttcacacaaaatctggacacagcgaat
cggctgatgagagcgcttagggttggaagcgtttggataaactgtttcgatgtatttgat
gccacaattccatttggagggtataagatgagtggcattggaagagagaaaggaatctac
agcctcaacaattacttgcaagtcaaggctgttgtcactgccctaaagaacccggcctgg
ctctaa

DBGET integrated database retrieval system