KEGG   Eutrema salsugineum: EUTSA_v10012616mgHelp
Entry
EUTSA_v10012616mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
eus  Eutrema salsugineum
Pathway
eus00052  Galactose metabolism
eus00500  Starch and sucrose metabolism
eus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EUTSA_v10012616mg
   00500 Starch and sucrose metabolism
    EUTSA_v10012616mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     EUTSA_v10012616mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF4131
Motif
Other DBs
NCBI-GeneID: 18018219
NCBI-ProteinID: XP_006399684
UniProt: V4LFF7
LinkDB All DBs
Position
Unknown
AA seq 775 aa AA seqDB search
MSPLQWFPTILIVVVVFFWSLPLPSHGSSQVLAEDEEVTVVGYGYVVRSVAVNSNQKVLT
AKLDLIKPSSVYAPDIQTLSLHVSLETSERLRIRLRDSSQQRWEIPETVISRAGNHSLRR
FLPEEGGGNSSENNILEDPSSDLVFTLHNTTPFGFSISRRSSGDVLFDTSPDPSDPNTYF
VFKDQFLQLSSALPENRSNLYGLGEHTKRSFRLKPGDTMTMWNADIGSEHPDVNLYGSHP
FYIDVRGSNGHDEAGTTHGVLLLNSNGMDVRYEGNRITYNVIGGIIDLYVFAGPSPEMVM
NQYTGFIGRPAPMPYWSFGFHQCRYGYNNVSDLESVVDGYKNAGIPLEVMWTDIDYMDGY
KDFTLDPVNFPEDKMKSFVDTLHKSGQKYVLILDPGINVNSSYGTYERGLKADVFIKRNG
EPYLGEVWPGKVYYPDFLNPAAATFWSNEIKMFQETLPSDGVWLDMNELSNFITSPLSPG
SSLDDPPYKINNLGGKTPINKKTVPATSIHFGNVSEYDAHNLYGLLEAKATHQAIVDLTG
KRPFILSRSTFVSSGKYTAHWTGDNAAKWEDLAYSIPGILNFGLFGIPMVGADICGFSYD
TTEELCRRWIQLGAFYPFARDHSSKGTAKQELYIWDSVASSARKVLGLRMRLLPHLYTLM
YEAHVTGVPIARPLFFSFPSDTKTYEIDSQFLIGKSIMVSPALEKGTTTVDAYFPAGIWF
DMFNYSIAVGGDSGKHVRLYTPADHVNVHVREGSKFSVCLFLSTTSFSVLTITVS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacttcagtggtttcctactatcctcatcgttgtcgtcgtcttcttctggagc
ttacctttgccctcacatggaagctcacaagtattagcagaagatgaagaagtcacagtc
gttggatacggctacgtcgtcagatcagtggccgttaattccaaccagaaggttttgacg
gcgaagcttgatttgatcaaaccatcgtccgtttacgcaccagatattcaaacacttagc
cttcatgtcagcttggagacaagtgagcgtttgagaatcagactcagggattctagtcaa
caaagatgggagataccggaaaccgtaatttctcgcgccggaaaccactctctacgccgt
ttcttaccggaagagggcggaggaaactcgtcggagaacaatatcctggaagatccatca
tcggacttagttttcaccctccacaacaccacgcccttcggtttctccatttccagaaga
tcctccggcgatgtcctcttcgacacatcgccggatccatcagatccaaacacttacttc
gtcttcaaagaccaattccttcaactatcttccgcgttaccggaaaaccgatcgaatctg
tacggtctcggagagcacacgaagcgatcgttcaggctaaaacccggcgacaccatgact
atgtggaacgccgacatcggcagcgagcatcccgatgtcaacctttacggatcgcacccg
ttctacatcgacgtaagaggatcaaacggccacgatgaagcagggacgactcacggcgtt
ctcttgctgaacagcaacggaatggacgtgaggtatgagggaaatcggattacttataat
gtgatcggcggtatcattgatctctatgtgttcgccggaccatcgccggaaatggtgatg
aatcagtatacagggtttatcggaagacctgcacctatgccttactggtcatttggattt
catcagtgtcggtatggatacaacaatgtctcagaccttgaatctgtagttgatggatat
aaaaatgctggaatacctcttgaggttatgtggacggacatagattacatggatggctac
aaagacttcactttggatcccgtgaatttccccgaggacaagatgaaatcgttcgtggat
acacttcacaagagcggtcagaaatacgtgctgatcttagatcctggtatcaatgtgaat
agctcttacgggacatatgaaagagggttgaaagcggatgttttcataaaacgaaatggt
gagccttatctcggtgaggtttggcctggaaaagtatactaccctgacttcttgaatcca
gctgctgcaactttctggagcaatgaaatcaagatgttccaggaaactctcccatcggat
ggtgtgtggcttgacatgaatgagttatcaaatttcataacttcacctctctcccctgga
tcctcactcgatgatcctccttacaagatcaacaacttagggggcaaaacgccgataaat
aaaaaaacagtacccgcaacatctatccattttggaaacgttagtgaatacgatgcgcat
aacttgtatggactcttggaagctaaagctactcaccaagccatagtggatttaacgggc
aagagaccgttcattttgtcaagatccacgtttgtaagctcggggaaatacacggctcac
tggaccggcgacaatgctgcaaaatgggaggatttggcttactcgatcccaggaattctc
aactttgggctgtttgggattccaatggttggagctgatatctgcggtttctcatatgat
accacagaggaattatgtcgtcgatggatccagctcggagcattttacccttttgcaaga
gatcattcgtccaaaggtactgctaaacaagaactgtacatctgggattcggttgcttct
tctgcaagaaaggttctcggccttcgtatgagactgctcccacatctttacacactaatg
tacgaggctcacgttaccggtgtcccgattgcgcgaccgctcttcttctccttccctagt
gacactaaaacctatgagattgattcgcagttcttgatcggaaaaagcataatggtatct
ccggcgctggagaaaggtacaactaccgtcgacgcatatttccccgccggaatctggttc
gatatgtttaactattcgattgctgtcggtggagattccggtaagcacgttaggctttat
actccggccgatcacgtcaatgttcatgttcgagaaggtagtaaattttccgtttgccta
ttcctaagtactactagtttttcggttttgacgataaccgtaagttga

DBGET integrated database retrieval system