KEGG   Eutrema salsugineum: EUTSA_v10012718mgHelp
Entry
EUTSA_v10012718mg CDS       T02985                                 

Definition
(RefSeq) hypothetical protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
eus  Eutrema salsugineum
Brite
KEGG Orthology (KO) [BR:eus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eus03016]
    EUTSA_v10012718mg
Enzymes [BR:eus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     EUTSA_v10012718mg
Transfer RNA biogenesis [BR:eus03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    EUTSA_v10012718mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-GeneID: 18018340
NCBI-ProteinID: XP_006398689
UniProt: V4LCN3
LinkDB All DBs
Position
Unknown
AA seq 806 aa AA seqDB search
MMTVRAINGCSIIRTATTGGGPPVSLFRHRIQRLRATHLREFSKLALGYPLLRSSRRFLG
QNTGGDAPSCSYSIHNLVDSVSEELESIRRRKGSRIRVRASVKVKLTSYGEVLEDKLVNQ
ELEAGLLLEFKKDPDRVLLAVAHRPDGKKNWMVFDQNGVTCSIKPQQITYIVPGVYNFDH
TELTGFLHRAQDNLDPQLLEFAWIELLEKNKPVTPEELAEMIYGRSDPLESYCAHFLLSK
DEIYFSVLESKGSRSIYAPRRTEQVDELLRRQRVKEAEEREFQEFILLLKSAKKAPSHAK
PPKSSWLADDQVRDKIGSLEAYAIDAWASTDQRKLAGMILKSMGLQKTAVSALNLLIDIG
YFPVHVNLDLLKLNLPTHHSEAIVEAAEALLSESSDLDVVRRIDLTHLKVYAIDVDEADE
LDDALSATRLQDGRIKIWIHVADPARYVTPGSKVDREARRRGTSVFLPTATYPMFPEKLA
MEGMSLRQGEICNAVSVSVVLRSDGSIAEYSVENSIIRPTYMLTYESAAELLHLNLEEEA
ELRLLSEAAFLRSQWRHEQGAVDTTTLETRIKVVNPEDPEPLINLYVENQAEPAMRLVFE
MMILCGEVVATFGSQHNIPLPYRGQPQSNIDVSAFAHLPEGPVRTSSIVKVMRAAEMNFR
CPVRHGVLGIPGYVQFTSPIRRYMDLTAHYQIKAFLRGGDNFPFSAGELEGIAASVNIQN
RVVRKLCNSGLRYWVIEFLRRQPKGKKYTALILRFVKDRIASLLLVEVGFQATAWVSEGK
QVGDEVEVRVEEAHPRDDLILLKEAL
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggtgagggcaatcaatggttgctccatcattcgcaccgcgactaccggcggc
ggtcctccggtttccctatttcgccaccgtattcagcgcctcagagcgactcatctccgg
gaattctcgaaattagcgttaggttatccacttctccggtcgagtaggcggtttctcgga
cagaataccggtggcgatgctccgagttgctcgtattccattcataatctggtcgacagt
gtttccgaagagctcgaatccattaggaggcgcaagggaagccgaatcagagttcgcgcc
agtgtgaaggtgaaattaacaagctacggagaggttcttgaggataagctagtaaaccag
gaactagaggcgggtttgcttctggagtttaagaaggacccagacagggtattgctggca
gttgctcacagacctgatggcaagaagaactggatggtctttgatcagaatggtgttact
tgttccatcaaaccgcagcaaattacgtacatcgtcccgggtgtttataatttcgaccat
acagaacttactggttttctccacagggctcaggataacttggatccccaactgcttgag
tttgcttggatcgagttacttgaaaagaacaaacctgtgacgccagaagagttagctgag
atgatctatggtcgctcagatcctctcgaaagctattgtgctcattttttgctatcgaaa
gacgagatatacttttctgtcttggagtctaaaggttctcgatcaatctatgccccccgc
cgtactgaacaggtggacgagcttttacgcaggcaacgtgtgaaggaggcagaagagaga
gagtttcaggagtttattttattgctgaagtctgccaaaaaggcgcctagtcacgccaag
ccccccaaatcgtcatggttagctgatgatcaagtccgagataagattggctcacttgaa
gcttatgctattgatgcatgggcaagcactgaccagcggaaattggctggaatgatccta
aaatccatgggattacagaaaacggctgtctcggctctaaaccttctcatagatattgga
tattttcctgtacatgtcaatcttgatctgctcaagctgaatcttcccacccaccactca
gaagcaatcgttgaagctgctgaagctcttctttcagagtcatctgatcttgatgtggtt
aggaggattgatctcacacacttgaaggtttatgcaattgatgttgatgaggctgatgag
cttgacgatgccctgagtgcaacaagattgcaggatggaaggataaagatttggatacat
gttgctgatcctgctagatatgttacacctgggagcaaagtggacagagaggcaaggaga
aggggaacttctgtctttcttccgacggctacttatcccatgtttccagaaaaacttgcc
atggaaggaatgagtttgagacaaggagaaatatgcaacgctgtctctgtgtctgttgtc
ctgcgttctgatggcagcattgcagaatattccgtagaaaattcaattatcagaccgaca
tatatgttgacatacgaaagtgctgctgagctacttcacttaaacctggaagaagaggct
gagctgagattgctgtctgaagcagccttcctccgctctcaatggcgccatgagcagggt
gcagtggacacaactacactagaaacgcgcatcaaagtggtgaatcctgaagatccagaa
ccgttgataaatctatatgtggaaaatcaagcagaaccggcaatgagacttgtctttgaa
atgatgattctttgcggggaggttgtagcaacgttcgggtctcagcacaatattccattg
ccatacagaggacagccgcagtcaaatattgatgtatctgcatttgcgcatcttccagaa
ggacccgtacggacctcgtccattgtcaaagtgatgcgtgctgcagaaatgaatttcaga
tgtcctgttcgacatggagtgcttggaatccctggttacgttcagttcacatctcccatc
cgtcgatacatggatcttaccgcacactaccagataaaggcttttcttcgaggaggtgac
aattttcctttctcagctggtgagctagaaggcatagcagcatctgtaaacattcaaaac
cgagtggtgagaaaactctgcaacagcggtctccgttattgggtaatagagtttctcagg
agacaaccaaaaggcaaaaaatacaccgcattgatcctgagatttgtcaaagaccggatc
gcatcccttttgttggttgaggtgggttttcaagcaacggcttgggtatcagaaggaaaa
caagtgggagatgaagtcgaagttcgagtagaagaagctcatccccgcgacgatcttatt
cttctcaaagaagctctctag

DBGET integrated database retrieval system